PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010108028.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family NAC
Protein Properties Length: 367aa    MW: 42468.2 Da    PI: 6.7326
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010108028.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1791.2e-5571361129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeek.ewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPtdeelv++yL++k+++++++l +vikevd+yk+ePwdL++  k+ +ee+ +wyfFs++dkky+tg+r+nrat++g+Wkatg+dk++
  XP_010108028.1   7 VPPGFRFHPTDEELVDYYLRRKIASRRFDL-DVIKEVDLYKIEPWDLQElcKIGSEEQsDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAI 100
                     69****************************.9***************954555554445************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                     +s k+ l+g++ktLvfykgrap+g+k+dW+mheyrle
  XP_010108028.1 101 YS-KHDLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                     **.8899****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-615155IPR003441NAC domain
PROSITE profilePS5100559.6757155IPR003441NAC domain
PfamPF023657.7E-298135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MNAFSHVPPG FRFHPTDEEL VDYYLRRKIA SRRFDLDVIK EVDLYKIEPW DLQELCKIGS  60
EEQSDWYFFS HKDKKYPTGT RTNRATAAGF WKATGRDKAI YSKHDLIGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETDEN GTPQASWVVC RVFKKKIATS NMHRASEHEL PCWYDEQVSF  180
MPDLESPKQN SNSHLANNNY QLPYPCKKEL DHHLPYQLPQ EHFLPLLESP KLFQSTATMS  240
STTPSVASYS LLLNHASALH SSSLRQGEEI QHSHDQNFNP VVHGSNYNNV QIVDNHDQVT  300
DWRVLDKFVA SQLSQEDVSR ENSFSNAQSN SLHAPNNANV IDRHWEKQEQ VPENASSSAS  360
CQIELWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-51615614169Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010108028.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024029028.10.0NAC domain-containing protein 7
SwissprotQ9FWX21e-131NAC7_ARATH; NAC domain-containing protein 7
TrEMBLW9SFC60.0W9SFC6_9ROSA; NAC domain-containing protein 7
STRINGXP_010108028.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF126933106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-120NAC 007
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]