PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010107555.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family NAC
Protein Properties Length: 332aa    MW: 38128.6 Da    PI: 8.1401
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010107555.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1676.2e-52191481128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhP+deel+v+yL++kv +++l++ ++i+++d+yk++Pw+Lp k++ +++ew+fF++rd+ky++g+r+nra+ sgyWkatg+dk+++s+
  XP_010107555.1  19 LPPGFRFHPSDEELIVHYLRNKVVSRPLPAPSIITDIDLYKYNPWELPGKASFGDEEWFFFTPRDRKYPNGSRPNRAAGSGYWKATGTDKHIFST 113
                     79****************************999***************988899****************************************9 PP

             NAM  96 ..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +++ +g+kk Lvfykgr pkg+kt+W+m+eyrl
  XP_010107555.1 114 scGTKSIGVKKALVFYKGRPPKGVKTEWIMNEYRL 148
                     888999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-6211182IPR003441NAC domain
PROSITE profilePS5100558.91919182IPR003441NAC domain
PfamPF023652.9E-2620148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MEIMINMEQN NSTHDQLQLP PGFRFHPSDE ELIVHYLRNK VVSRPLPAPS IITDIDLYKY  60
NPWELPGKAS FGDEEWFFFT PRDRKYPNGS RPNRAAGSGY WKATGTDKHI FSTSCGTKSI  120
GVKKALVFYK GRPPKGVKTE WIMNEYRLLD SMIWSTTSTT TNPKRKGSMR LDDWVLCRVR  180
QKSNNNTRST WDSDRNCSSY NHDHDHQNHN HNPNQTCSKS TTSTPSQNLE MNMIIDYLYK  240
DFPMLPYIFA TSQQPLIPCV EKTTASSTVS FQSSENINPK PSSTGTSVSR YDDHGLKCRW  300
DMDIHQDQSI KGANDHDWSS KIQEISGPVY DL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-6651851171Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family associated with the grain protein content (GPC). Accelerates senescence and increases nutrient remobilization from leaves to developing grains. The tetraploid cultivated wheat (T.durum) contains one additional gene coding for a functional protein (NAM-A1) and one extra pseudogene (NAM-B1) (PubMed:17124321). Plays a weaker role in terminal senescence than NAM-A1. {ECO:0000269|PubMed:17124321, ECO:0000269|PubMed:22278768}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010107555.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010107555.20.0NAC domain-containing protein 18
SwissprotA0SPJ66e-80NAMB2_TRITD; NAC transcription factor NAM-B2
TrEMBLW9SLK60.0W9SLK6_9ROSA; NAC domain-containing protein 29
STRINGXP_010107555.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24162981
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.12e-78NAC domain containing protein 25
Publications ? help Back to Top
  1. Uauy C,Distelfeld A,Fahima T,Blechl A,Dubcovsky J
    A NAC Gene regulating senescence improves grain protein, zinc, and iron content in wheat.
    Science, 2006. 314(5803): p. 1298-301
    [PMID:17124321]