PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010107411.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family HD-ZIP
Protein Properties Length: 770aa    MW: 84626.7 Da    PI: 6.3548
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010107411.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox68.39.7e-2269124156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     ++k +++t++q++eLe++F+++++p++++r eL+k+lgL+++qVk+WFqNrR+++k
  XP_010107411.1  69 KKKYHRHTPNQIQELEAFFKECPHPDEKQRLELSKRLGLETKQVKFWFQNRRTQMK 124
                     79999************************************************999 PP

2START195.62.3e-612815042206
                     HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
           START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                     la++a++e++k+a+a+ p+W ks     e +n++e++++f++  +     + +ea r+s vv+ ++  lve+l+d + +W+e+++    +a+t+e
  XP_010107411.1 281 LALAAMDEFIKMAQANGPLWIKSTnggkETLNYEEYMRTFPSCIGpkpsnYVSEATRDSSVVIINSLALVETLMDAN-RWTEMFPclvaRASTIE 374
                     6899************************************998889***9***************************.***************** PP

                     EECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE CS
           START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvd 171
                      is+g      galq+++aelq+lsplvp R   f+R+++q+ +g+w++vdvSvd +++ ++  s+  +++lpSg+l++++++g+skvtw+eh +
  XP_010107411.1 375 MISTGiggtrnGALQVINAELQVLSPLVPlRPLKFLRFCKQHADGVWAVVDVSVDINRDATNANSYFHCRRLPSGCLVQDMPDGYSKVTWIEHSE 469
                     *********************************************************************************************** PP

                     --SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 172 lkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     ++++ +h+++rs +  g+ +ga++w+atlqrqce+
  XP_010107411.1 470 YDDSGVHQMFRSYLICGMGFGAQRWLATLQRQCEC 504
                     *********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.8E-2354120IPR009057Homeodomain-like
SuperFamilySSF466895.43E-2155126IPR009057Homeodomain-like
PROSITE profilePS5007118.04266126IPR001356Homeobox domain
SMARTSM003894.5E-2068130IPR001356Homeobox domain
PfamPF000462.5E-1969124IPR001356Homeobox domain
CDDcd000862.21E-2069126No hitNo description
PROSITE patternPS000270101124IPR017970Homeobox, conserved site
PROSITE profilePS5084841.437271507IPR002913START domain
SuperFamilySSF559616.46E-31272504No hitNo description
CDDcd088751.52E-118275503No hitNo description
SMARTSM002344.0E-46280504IPR002913START domain
PfamPF018528.1E-53281504IPR002913START domain
SuperFamilySSF559612.2E-19524742No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 770 aa     Download sequence    Send to blast
MQFSVLAESG SRWRNMDSHG EMGLLGENFD LGIIGRMRDD GYESRSGSDN LEGASGDDQD  60
AGDDQPRKKK KYHRHTPNQI QELEAFFKEC PHPDEKQRLE LSKRLGLETK QVKFWFQNRR  120
TQMKTQLERH ENIILRQEND KLQAENNMMK DAMATPMCNQ CGGPAIPGQI SFEEHQLRIE  180
NARLKDELNR ICALANKFLG RPLSSLATPI PLPSSTSSLE LAVGRNGMGG LNVVGAPLPM  240
GLELGDGISS AGPMIPMMKH TMGMNVMGTE IPFERSMLID LALAAMDEFI KMAQANGPLW  300
IKSTNGGKET LNYEEYMRTF PSCIGPKPSN YVSEATRDSS VVIINSLALV ETLMDANRWT  360
EMFPCLVARA STIEMISTGI GGTRNGALQV INAELQVLSP LVPLRPLKFL RFCKQHADGV  420
WAVVDVSVDI NRDATNANSY FHCRRLPSGC LVQDMPDGYS KVTWIEHSEY DDSGVHQMFR  480
SYLICGMGFG AQRWLATLQR QCECLAILTS PSISNENQLA MSPSGKRSML KLAQRMVDNF  540
CAGVTASTVR KWDKLCVGTV GEDVRVMTRK SMDDPGEPPG IILSAATSVW IPVSQKRLFE  600
FLRDERFRSD WDILSNGGPM QEMVHITKCQ RHGNHVSLLR ASTIGTNDSS MLILQETWND  660
ASGSMVVYAP VDRASINVVM HGGDSAYVAL LPSGFAILPD GSSQPNYCSG PSVKGEASNG  720
EGGGGGCLLS VGFQILVNSL PTAKLTVESV ETVNNLISCT IQKIKAALNV
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010107411.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010107411.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLW9RWW90.0W9RWW9_9ROSA; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
STRINGXP_010107411.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]