PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010107134.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family MYB_related
Protein Properties Length: 911aa    MW: 100946 Da    PI: 6.9526
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010107134.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.25.7e-1687131147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
   XP_010107134.1  87 RERWTEEEHNRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 131
                      78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.2E-1681137IPR009057Homeodomain-like
PROSITE profilePS5129419.54482136IPR017930Myb domain
TIGRFAMsTIGR015571.2E-1685134IPR006447Myb domain, plants
SMARTSM007177.3E-1386134IPR001005SANT/Myb domain
PfamPF002493.9E-1387130IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-887127IPR009057Homeodomain-like
CDDcd001671.88E-989132No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 911 aa     Download sequence    Send to blast
MRDRASKGCP DGFLILHVFT GRFWRLRVRF VAIPYNVLLS TTTTALPLLA VDVVRNHGKF  60
SLYPLLVRED LKQRQLPRKP YTITKQRERW TEEEHNRFLE ALKLYGRAWQ RIEEHIGTKT  120
AVQIRSHAQK FFSKINSIVI QFKRDNLNKL QVWKSKSGFT EVMGRYQMKL DCEEAIRMTV  180
LYEVLYNLLK VDISQYPCHS VSGRAQPCSK ASKVLPMHEV IERSNNYVHK HCLLEKEALV  240
KGVPVGQAID IDIPPPRPKR KPSNPYPRKT SAGTSTSQVG AKDGKYLSSE FSHHCKQVLD  300
LEKEPLPEKS GGEGKRTNTK ENQDDNCSEV LTQLQEHCSS AFKRSTPKPP VGLRNACTFR  360
ELVPSMKKAN QDDPSGSYVT VELDGNQNVE KADVTEMTVE DNDASRNLKL ENANSSDEKM  420
DDLSCGAPTE EMQTTQKYPR HVPVHVLDGS LGTCTQMPSS DMPFKEPIFH PVGEVRGHHN  480
LFANSAASAT TEHQSNASRT SAHQSFRAFH PPFTPIRHNQ DDYQSFLHMS STFSSLIVST  540
LLQNPAAHAA ASFASTFWPH SNVEASADSP AFNQGCSTPS MAAIAAATVA AATAWWASHG  600
LLPLCAPLNT AFTCTPSISG VPSIHTDQVP AANAERGENS LNPPLQDQAD PEYSDALQAQ  660
HSALKSPAAS SSDSEESGSA KHKSNSKAAD HENAAATTEL HDSNKAKGRK QVDRSSCGSN  720
TASSSEVETD ALEKHENEKE ESKEPDADNP IAEMINRRSK SNSNTSDSWK EVSEEGRLAF  780
QALFSREVLP QSFSPPYDDE NNQENQNDHA KEKQMEEDKD GGASLLDLNI RTSNLQESEK  840
KESPRGDNNL DEGLLTIGLG YGKLKARRTG FKPYKRCSVE AKENLVGSTA SQGEEKGTKR  900
LRLEGEVQLN V
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010107134.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024028464.10.0protein LHY
RefseqXP_024028465.10.0protein LHY
RefseqXP_024028466.10.0protein LHY
TrEMBLW9S4110.0W9S411_9ROSA; Protein LHY
STRINGXP_010107134.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48602537
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.42e-77MYB_related family protein