PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010107118.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family NAC
Protein Properties Length: 624aa    MW: 69335.9 Da    PI: 4.5364
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010107118.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM103.52.7e-3291341127
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikev.diykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     lp+G+ F+Ptdee++++yLk k+ gk+ ++++ i+ev d+++++Pw+Lp  +k+k++++ w+fF++rd + +    ++r+tk+g W  tg++ ++
  XP_010107118.1   9 LPVGVGFRPTDEEIMNHYLKLKMIGKDSKVDNGIAEVnDVCTFDPWELPpkSKIKSKDQIWWFFTRRDPERK---TTKRKTKTGSWGLTGEEGQI 100
                     799***************************888****9**********87459999999*******998765...68889999************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyr 127
                     + ++g++ g+kk  vf++   ++g++++Wv+ ey+
  XP_010107118.1 101 KGRDGRVLGTKKYVVFFN-GPNRGRRSNWVIREYH 134
                     *****************5.67789**********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-337155IPR003441NAC domain
PROSITE profilePS5100538.6639155IPR003441NAC domain
PfamPF023655.8E-1710134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 624 aa     Download sequence    Send to blast
MTISLPEDLP VGVGFRPTDE EIMNHYLKLK MIGKDSKVDN GIAEVNDVCT FDPWELPPKS  60
KIKSKDQIWW FFTRRDPERK TTKRKTKTGS WGLTGEEGQI KGRDGRVLGT KKYVVFFNGP  120
NRGRRSNWVI REYHPLPENV LPKQRHYVIC RLEYKTDEKA GLTSRNEGEP SCNITSEVEI  180
APSAISEVHG HAEGNAESPS QLVFSPDDFL TEVEMSSIFE DCLNDDQKAQ FVHENHPNPE  240
NSLPHQMPDL TCCLESKTDE NSGTLGCNIG EPSIEIRAEI ENPVAHAAIS EVPGHGEGNA  300
KVLSQPVLSP DDYLTAEDIR SIFSDGFNGG QKINSVMLEH HPELDNNLPQ QMPDLTCCLE  360
SKTDENSGTL GCNIGEPSIE IRAEIENPVA HAAISEVPGH GEGNAKVLSP DDYLTAEDIR  420
SIFSDGFNGG QKINSVMHEH HPELDSNLPQ QWPYLTCCLE NKTDESVGSL DCNIGRPSSN  480
ITSDIENQVA PTAIPVVHGD TEVNAELLWQ TFLTPDHHAT EKDISLILSN SLSDDHHNEW  540
HALCGAAEPE MPPAEFLDRR KADSYENYYG ESETTNDLFN NFIQPKSLKR PYFPDIPANN  600
DMNAGGVDGR VKRPRSLALG ECLQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A5e-19916020172NAC domain-containing protein 19
3swm_B5e-19916020172NAC domain-containing protein 19
3swm_C5e-19916020172NAC domain-containing protein 19
3swm_D5e-19916020172NAC domain-containing protein 19
3swp_A5e-19916020172NAC domain-containing protein 19
3swp_B5e-19916020172NAC domain-containing protein 19
3swp_C5e-19916020172NAC domain-containing protein 19
3swp_D5e-19916020172NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010107118.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010107118.10.0uncharacterized protein LOC21402535 isoform X2
TrEMBLW9SKD60.0W9SKD6_9ROSA; NAC domain-containing protein 1
STRINGXP_010107118.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20652586
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35580.13e-32NAC transcription factor-like 9