PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010107043.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family HD-ZIP
Protein Properties Length: 235aa    MW: 27331.9 Da    PI: 8.2808
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010107043.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox634.5e-20114168256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ ++tkeq+  Le +F++n +++ ++++eLA++l+L+ rqV vWFqNrRa+ k
  XP_010107043.1 114 RKKLKLTKEQTMFLEGCFKSNTTLNPAQKRELAEQLNLKPRQVEVWFQNRRARTK 168
                     788899***********************************************98 PP

2HD-ZIP_I/II117.57.8e-38114202189
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                     +kk++l+keq  +LE +F+++++L+p +K ela++L+l+prqv+vWFqnrRARtk+kq+E+d+e Lk+++++l +en+rL+ke +eLr+
  XP_010107043.1 114 RKKLKLTKEQTMFLEGCFKSNTTLNPAQKRELAEQLNLKPRQVEVWFQNRRARTKMKQTEEDCELLKKCCESLGQENKRLRKELQELRS 202
                     69*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.3E-19100171IPR009057Homeodomain-like
PROSITE profilePS5007117.103110170IPR001356Homeobox domain
SMARTSM003898.3E-16112174IPR001356Homeobox domain
PfamPF000462.6E-17114168IPR001356Homeobox domain
CDDcd000862.07E-15114168No hitNo description
Gene3DG3DSA:1.10.10.605.6E-19119168IPR009057Homeodomain-like
PROSITE patternPS000270145168IPR017970Homeobox, conserved site
SMARTSM003405.2E-13170213IPR003106Leucine zipper, homeobox-associated
PfamPF021835.0E-9170202IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MGNKEEEACK LGLGVGEQYY AATQTKDDHD HDHDHGKKIK QPMVCLRLDL CRFEVFPKDD  60
HDHTDHRSIL FEGHSSLKPK NNHNIIHDDD QENHVGNRGS TRNENNITNG GISRKKLKLT  120
KEQTMFLEGC FKSNTTLNPA QKRELAEQLN LKPRQVEVWF QNRRARTKMK QTEEDCELLK  180
KCCESLGQEN KRLRKELQEL RSIRVEQCHG KLDDIQFANN VKLTMCPNCQ KLSKN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1162170RRARTKMKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010107043.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010107043.11e-175homeobox-leucine zipper protein HAT14
SwissprotP466653e-44HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLW9S3T91e-174W9S3T9_9ROSA; Homeobox-leucine zipper protein HAT14
STRINGXP_010107043.11e-174(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.13e-36homeobox from Arabidopsis thaliana