PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010106814.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family TCP
Protein Properties Length: 363aa    MW: 38288.9 Da    PI: 4.9817
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010106814.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP112.65.5e-3584154373
             TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                     ++k++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++ti WLl+ a+pai+e+tgt++ +a ++
  XP_010106814.1  84 AAKRPSKDRHTKVEGRGRRIRMPATCAARIFQLTRELGLKSDGETIRWLLEHAEPAIIEATGTGTVPAIAV 154
                     5799***********************************************************77776333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.1E-2789155IPR005333Transcription factor, TCP
PROSITE profilePS5136927.01789143IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0031347Biological Processregulation of defense response
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MEETDEIIDG TNSDDNVSAS DASIVEPEPP ESNFSAEETA PAPPPQPAVL MKEEFSDAER  60
ELDEKSLPMG LLQVPSPGNK QVVAAKRPSK DRHTKVEGRG RRIRMPATCA ARIFQLTREL  120
GLKSDGETIR WLLEHAEPAI IEATGTGTVP AIAVSVGGTL KIPTTSPARP NGEIAEVLRK  180
RRRRASNSEF VDVNDQISVS SGLAPIAPTT YGNGAAQGLV PLWPMGPNGG AAGPFLMFPN  240
SGAVPGLANH AQLWAIPAAA ATPSFFGVQA RPISNFVSAL QPVQLRDSQV SSGSVSKTFS  300
STVETTSNAM ISTSDGVGAS SSCSTTTSAT QMLRDFSLEI YDKKELQFLG GRSSNSQTQC  360
SKP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1178182RKRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00007PBMTransfer from 495258Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010106814.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010106814.10.0transcription factor TCP19
SwissprotQ9LT895e-77TCP19_ARATH; Transcription factor TCP19
TrEMBLW9RV440.0W9RV44_9ROSA; Uncharacterized protein
STRINGXP_010106814.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21183086
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51910.24e-78TCP family protein