PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010106446.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family WOX
Protein Properties Length: 290aa    MW: 32094.4 Da    PI: 8.2113
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010106446.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox651e-202584357
                    --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
        Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                    +R+++tkeq+++Le l+++  r+psae++++++++l    +++ ++V++WFqN++a++++
  XP_010106446.1 25 SRWNPTKEQINILEGLYRQgIRTPSAEQIKQITSRLrtfgHIEGKNVFYWFQNHKARQRQ 84
                    7*****************99**************************************96 PP

2Wus_type_Homeobox1153.8e-372386265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       a++RW+Pt+eQi+iLe ly++G+rtP++e+i++it++L+++G+ie+kNVfyWFQN+kaR+rqkq
     XP_010106446.1 23 ASSRWNPTKEQINILEGLYRQGIRTPSAEQIKQITSRLRTFGHIEGKNVFYWFQNHKARQRQKQ 86
                       689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.8032085IPR001356Homeobox domain
SuperFamilySSF466896.42E-132191IPR009057Homeodomain-like
SMARTSM003892.3E-42289IPR001356Homeobox domain
PfamPF000462.0E-182584IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.2E-82584IPR009057Homeodomain-like
CDDcd000866.32E-62686No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MEADNGESNI GAGSSSGSGA PPASSRWNPT KEQINILEGL YRQGIRTPSA EQIKQITSRL  60
RTFGHIEGKN VFYWFQNHKA RQRQKQKQEN MAYINRFLHR TPQPFFPPSH QLPYPNVVCG  120
PYYVPVESQT DHHHTATAFR QQYHPNKMSL SNGVKRRSPI RLDKSENIST GTISCAVGTG  180
YEPVREDYYG YKSTISSSCF DEGVRNNKLI MSTSSCNQET LALFPLSPTG VLKAGSEEEN  240
PDHGSSGFFD TEINPSTSNG STPASSSSGV EEGRCSSAGL GQTFYDFFSR
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010106446.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010106446.10.0WUSCHEL-related homeobox 2
TrEMBLW9S2530.0W9S253_9ROSA; WUSCHEL-related homeobox 2
STRINGXP_010106446.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.17e-51WUSCHEL related homeobox 2