PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010104346.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family NAC
Protein Properties Length: 346aa    MW: 39112.6 Da    PI: 5.4551
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010104346.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.16.9e-5361341128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFhPtdeelv +yLk+kveg ++el evi+ +d+yk++Pw+Lp k  + +++ ew+fF++rd+ky++g+r+nratk+gyWkatgkd++v+
  XP_010104346.1   6 LPPGFRFHPTDEELVGYYLKRKVEGLEIEL-EVIPVIDLYKFDPWELPeKsFLPKRDMEWFFFCPRDRKYPNGSRTNRATKAGYWKATGKDRKVV 99 
                     79****************************.99**************95344555788************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +k+ +++  +ktLvfy grap g++tdW+mheyrl
  XP_010104346.1 100 CKSVNVIAYRKTLVFYCGRAPLGNRTDWIMHEYRL 134
                     *999*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.72E-594157IPR003441NAC domain
PROSITE profilePS5100557.196157IPR003441NAC domain
PfamPF023655.4E-297134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MGGASLPPGF RFHPTDEELV GYYLKRKVEG LEIELEVIPV IDLYKFDPWE LPEKSFLPKR  60
DMEWFFFCPR DRKYPNGSRT NRATKAGYWK ATGKDRKVVC KSVNVIAYRK TLVFYCGRAP  120
LGNRTDWIMH EYRLSDGLSQ GSPNFHGAFA LCRVVRKNES TQKVSDCHGE PKSKKIGSSS  180
SNADFNSTLV NEPLSVSGDI SSHASYQYNE SRFSSPITSP NEVTPASEFE PSFAETNPAS  240
FWVSPDLILD SSKDYPQLQA AIPDYFPQYE FPGSVTPWPS YEHREISPSS SYSNFTGEIE  300
LSDNPNRIGG MSPYPGHSNY MDVFANEDMQ YEGYDQTSSL SCLKPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-53516316171NO APICAL MERISTEM PROTEIN
1ut4_B6e-53516316171NO APICAL MERISTEM PROTEIN
1ut7_A6e-53516316171NO APICAL MERISTEM PROTEIN
1ut7_B6e-53516316171NO APICAL MERISTEM PROTEIN
3swm_A8e-53516319174NAC domain-containing protein 19
3swm_B8e-53516319174NAC domain-containing protein 19
3swm_C8e-53516319174NAC domain-containing protein 19
3swm_D8e-53516319174NAC domain-containing protein 19
3swp_A8e-53516319174NAC domain-containing protein 19
3swp_B8e-53516319174NAC domain-containing protein 19
3swp_C8e-53516319174NAC domain-containing protein 19
3swp_D8e-53516319174NAC domain-containing protein 19
4dul_A6e-53516316171NAC domain-containing protein 19
4dul_B6e-53516316171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in tissue reunion of wounded inflorescence stems. Required for the division of pith cells in the reunion process, which is dependent on polar-transported auxin and the wound-inducible hormones ethylene and jasmonate (PubMed:21911380). Binds to the promoters of XTH19 and XTH20 to induce their expression via auxin signaling. XTH19 and XTH20 are involved in cell proliferation in the tissue reunion process of incised stems (PubMed:25182467). Involved in hypocotyl graft union formation. Required for the auxin- mediated promotion of vascular tissue proliferation during hypocotyl graft attachment (PubMed:27986917). {ECO:0000269|PubMed:21911380, ECO:0000269|PubMed:25182467, ECO:0000269|PubMed:27986917}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010104346.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by wounding in the flowering stem. {ECO:0000269|PubMed:21911380}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4309455e-36AM430945.2 Vitis vinifera contig VV78X241223.4, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010104346.20.0NAC domain-containing protein 71 isoform X2
SwissprotO496971e-108NAC71_ARATH; NAC domain-containing protein 71
TrEMBLW9SCT90.0W9SCT9_9ROSA; NAC domain-containing protein 74
STRINGXP_010104346.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67223450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.11e-110NAC domain containing protein 71
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Asahina M,Satoh S
    Molecular and physiological mechanisms regulating tissue reunion in incised plant tissues.
    J. Plant Res., 2015. 128(3): p. 381-8
    [PMID:25736731]
  3. Matsuoka K, et al.
    Differential Cellular Control by Cotyledon-Derived Phytohormones Involved in Graft Reunion of Arabidopsis Hypocotyls.
    Plant Cell Physiol., 2016. 57(12): p. 2620-2631
    [PMID:27986917]