PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010103375.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family ARR-B
Protein Properties Length: 691aa    MW: 75064.2 Da    PI: 6.369
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010103375.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.71.1e-27212265155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kpr++W+peLH++Fv av+qL G +kA Pk+il+lm+v+gLt+e+v+SHLQk+R 
  XP_010103375.1 212 KPRVVWSPELHKKFVAAVHQL-GVDKAFPKKILDLMNVEGLTRENVASHLQKFRG 265
                     79*******************.********************************5 PP

2Response_reg81.13.5e-27261341109
                     EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTT CS
    Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaG 93 
                     vl vdD+p+ +++l+++l+k +y +v+++ ++ +al++l e++  +Dl++ D++mp+mdG++ll+     +++lp+i+++ah++ +++ + +  G
  XP_010103375.1  26 VLAVDDDPICLKVLENLLRKCQY-QVTTTNQAVKALKMLVENRnkFDLVISDVNMPDMDGFKLLELVG-LDMELPVIMLSAHSDTKLVMKGVTHG 118
                     799********************.***************555557*******************8764.4669********************** PP

                     ESEEEESS--HHHHHH CS
    Response_reg  94 akdflsKpfdpeelvk 109
                     a d+l Kp+ +eel +
  XP_010103375.1 119 ACDYLLKPVRIEELKN 134
                     *************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.8E-1541661IPR017053Response regulator B-type, plant
SuperFamilySSF521723.98E-3623147IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23002.0E-4223174No hitNo description
SMARTSM004482.3E-3324136IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011044.02125140IPR001789Signal transduction response regulator, receiver domain
PfamPF000725.2E-2526134IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.62E-2927140No hitNo description
SuperFamilySSF466893.4E-19209269IPR009057Homeodomain-like
PROSITE profilePS5129413.101209268IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-28210269IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-23212264IPR006447Myb domain, plants
PfamPF002491.2E-8214263IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 691 aa     Download sequence    Send to blast
MTVEDQRGSD GGKYVSLDRF PVGMRVLAVD DDPICLKVLE NLLRKCQYQV TTTNQAVKAL  60
KMLVENRNKF DLVISDVNMP DMDGFKLLEL VGLDMELPVI MLSAHSDTKL VMKGVTHGAC  120
DYLLKPVRIE ELKNIWQHVI RRRKLDTKDQ SKSPNHDKAC RENGEGGKGV AATGNEDQNV  180
KFNRKRKDQN KDEEEEGEEK GRENEDPSTQ KKPRVVWSPE LHKKFVAAVH QLGVDKAFPK  240
KILDLMNVEG LTRENVASHL QKFRGYLKKA SMVPAIGGKD TSYMRTGALE GFGDLHSLAG  300
SVRLANTALS SSLTHGRMLR RLNSPAGLTL TGSTSTGLIQ LSNPQNLSNS VKNLLQQTKC  360
PNHLVDISAL NNPTGFTVSS GLQDARAAVA SSSTAPNYSS NTLMLPGIAQ QTHSGGALGN  420
QSSVRVAASD PKAFDLEIND SSNFLDHNHC NESWQGAVQA SKFPSTAFPM SGPSNQGQMR  480
CNNLVISSTT SQIGKNPHNF SSASSLPTPL GDSRGDIEGQ DGFIGNIVHT ANFTARQRWE  540
EHGKDNQGLN QNSNAINSFV SANAINSLNQ SLDQNNAGCS QSFNASILDE LNGGTLSVFQ  600
PSEIGESAAD TKTEPSGNYL FEQAKAPDAL QDSYGLIDDI ICAMMKQCVH CVYIVTALPC  660
VIQGQNETTL MDGEFGLDTC SLGSWMQDFT A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-24208271164ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010103375.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024025851.10.0LOW QUALITY PROTEIN: two-component response regulator ORR23
TrEMBLW9RL080.0W9RL08_9ROSA; Two-component response regulator
STRINGXP_010103375.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-112response regulator 12