PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010103318.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family NAC
Protein Properties Length: 296aa    MW: 33836 Da    PI: 8.5566
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010103318.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM148.33.9e-46171423128
             NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.. 95 
                     pGfrFhPt+eel+++yL++ ++gk  ++ ++i  ++iy+++P dLp k+k +e+ewyfF++rd+k+ +g r+nr+t++g+Wkatg+d++++s   
  XP_010103318.1  17 PGFRFHPTEEELLDFYLRNMISGKM-RF-DIIGYLNIYHYDPCDLPGKAKIGEREWYFFVPRDRKHGSGGRPNRTTERGFWKATGSDRKIVSLse 109
                     9*********************998.45.78***************99999***************************************99755 PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++++gl+ktLvfykgrap+g+ktdWvm+eyrl
  XP_010103318.1 110 LKRVIGLRKTLVFYKGRAPRGTKTDWVMNEYRL 142
                     5677***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-5310160IPR003441NAC domain
PROSITE profilePS5100553.30115160IPR003441NAC domain
PfamPF023652.8E-2517142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0010200Biological Processresponse to chitin
GO:0045792Biological Processnegative regulation of cell size
GO:0048281Biological Processinflorescence morphogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MAANNMEEVA SDVLELPGFR FHPTEEELLD FYLRNMISGK MRFDIIGYLN IYHYDPCDLP  60
GKAKIGEREW YFFVPRDRKH GSGGRPNRTT ERGFWKATGS DRKIVSLSEL KRVIGLRKTL  120
VFYKGRAPRG TKTDWVMNEY RLPDHCKLSK DIVLCKVYRK ATSLKVLEQR VAMEEELKNL  180
QNACPASPMD TCISFCSPQE EKTPPQVPSV TIHQLVPMKK EVEEVANIET KHGERAILGV  240
KGSSASLQLP QGYKEKLPEI QVPRELGLDW AAQDNWSLLN SPWLQSLTPL ANLLNF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A4e-441716322171NAC domain-containing protein 19
3swm_B4e-441716322171NAC domain-containing protein 19
3swm_C4e-441716322171NAC domain-containing protein 19
3swm_D4e-441716322171NAC domain-containing protein 19
3swp_A4e-441716322171NAC domain-containing protein 19
3swp_B4e-441716322171NAC domain-containing protein 19
3swp_C4e-441716322171NAC domain-containing protein 19
3swp_D4e-441716322171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010103318.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010103318.10.0NAC domain-containing protein 22
SwissprotQ10S655e-90NAC22_ORYSJ; NAC domain-containing protein 22
TrEMBLW9S9V70.0W9S9V7_9ROSA; Putative NAC domain-containing protein 94
STRINGXP_010103318.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62143251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.11e-109NAC domain containing protein 36
Publications ? help Back to Top
  1. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]