PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010103069.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family NAC
Protein Properties Length: 602aa    MW: 66687.9 Da    PI: 4.7408
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010103069.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.12.5e-51151411127
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lp GfrF+Ptdeelv++yL+ k++g+   + +vi+e+d++k+ePwdLp  +++ +++ ew+fF+++d+ky++g+r nratk+gyWkatg+d++++
  XP_010103069.1  15 LPLGFRFRPTDEELVDYYLRLKINGEVQLV-SVIREIDVCKLEPWDLPdlSMIPTRDPEWFFFCPQDRKYPNGHRLNRATKAGYWKATGRDRKIK 108
                     699*********************998655.99**************96447778999************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyr 127
                     s ++ ++g+kktLvfy+grapkg++t+Wvmheyr
  XP_010103069.1 109 S-GTLQIGMKKTLVFYTGRAPKGKRTNWVMHEYR 141
                     *.999****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-596165IPR003441NAC domain
PROSITE profilePS5100556.12815165IPR003441NAC domain
PfamPF023651.1E-2716141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 602 aa     Download sequence    Send to blast
MAVGEMAVLS SLNSLPLGFR FRPTDEELVD YYLRLKINGE VQLVSVIREI DVCKLEPWDL  60
PDLSMIPTRD PEWFFFCPQD RKYPNGHRLN RATKAGYWKA TGRDRKIKSG TLQIGMKKTL  120
VFYTGRAPKG KRTNWVMHEY RPTLQELDGT NPGQSPFVLC RLFKKHDESI EGVNCEAAET  180
TVSSPITKSS PVDTQSEQEV TLGPLASGKQ PEMLPTKIEY SMIETFDDMT SEAGGAIAFP  240
SNSYSAYDAG DQGIEETASE SDQELEEDLK IFYAPTPGPL DCKIFSPLHS QMQAELGSSC  300
MYYPVANDCS TGHSGVQFQY GTNESDDVTQ FLKSVLNNSG EDATEDFVTE NNQVVESTTM  360
TNAASGFNGV LYGDGQAQLE KLEAGLQGAM SFVGTFPGEA SIYTENPEDH STGYLAHAEP  420
YSRNVLPFGS AVSINDLNPI LNEDSGPVII RRTRQLQNPP SSIETEAPHV TMIQGAAPRR  480
LRLQKKLQIS CSFKSVGRQN NKPEEESKPV VKEEEKAVEQ HATGSVDEPQ KTPFSGPVDD  540
GKTCQEPGTT MRSYSISKTG KKKVISVFSE TGSTWLFSFM FRVVVFAVLF ISFTSMWRCL  600
NF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-451416814171Stress-induced transcription factor NAC1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010103069.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010103069.10.0protein NTM1-like 9
TrEMBLW9RKC50.0W9RKC5_9ROSA; NAC domain-containing protein 78
STRINGXP_010103069.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF55513353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35580.11e-100NAC transcription factor-like 9