PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010102025.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family NAC
Protein Properties Length: 509aa    MW: 57522.5 Da    PI: 8.0358
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010102025.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM151.73.5e-47181441128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                     + pGfrF+Ptdeel+++yLk+k++g + ++ evi+ev+i k+ePw+L  k+v  +e+ew+fFs+r +ky++g++++rat+ gyWkatgk+++v+s
  XP_010102025.1  18 MFPGFRFSPTDEELISYYLKNKMDGADKSV-EVIPEVEIWKYEPWELLdKSVIPSETEWFFFSPRGRKYPNGSQSKRATELGYWKATGKERNVKS 111
                     579************************999.99**************7566666899************************************** PP

             NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +++ +g+k+tLvf++grapkge+t+W+mhey +
  XP_010102025.1 112 -GSTFIGTKRTLVFHTGRAPKGERTEWIMHEYCV 144
                     .999****************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.93E-5410159IPR003441NAC domain
PROSITE profilePS5100552.09518160IPR003441NAC domain
PfamPF023651.7E-2520143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 509 aa     Download sequence    Send to blast
MAGAPSREAQ MSIAALSMFP GFRFSPTDEE LISYYLKNKM DGADKSVEVI PEVEIWKYEP  60
WELLDKSVIP SETEWFFFSP RGRKYPNGSQ SKRATELGYW KATGKERNVK SGSTFIGTKR  120
TLVFHTGRAP KGERTEWIMH EYCVLDKSQD FMVVCRLRKN SEFRLNDSNR ASSSQRPLST  180
MHNSNCAASE VGTEPGDKAN ECCSKKCSSS YDSYSIEQID SASESSQKLA SEVTQPECSG  240
QQKDYDDDDD FFAEILKDDI IKLDETLISA ALDISPLAAF VPEEVQKSQQ PGEAAVSQDL  300
PFQGTANRRI RLKKETVRTN REKAMENTAS TKSDYLVGKN TRPNSKESPK CSASVLSART  360
TASRHLILAV FLLLAFMALF ASLLGGFWRV RMTICFVTTP CKMSRPMLLV FLLLILIITS  420
QFEWKQPVID VDMNPSISQK QQRISKREEA VKEKIILSQE KNIQRLNELV RSLREQLHQC  480
RGNNEKANAT VRPLTEHVLG LERQQLLEG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-431315912164NO APICAL MERISTEM PROTEIN
1ut4_B4e-431315912164NO APICAL MERISTEM PROTEIN
1ut7_A4e-431315912164NO APICAL MERISTEM PROTEIN
1ut7_B4e-431315912164NO APICAL MERISTEM PROTEIN
3swm_A5e-431315915167NAC domain-containing protein 19
3swm_B5e-431315915167NAC domain-containing protein 19
3swm_C5e-431315915167NAC domain-containing protein 19
3swm_D5e-431315915167NAC domain-containing protein 19
3swp_A5e-431315915167NAC domain-containing protein 19
3swp_B5e-431315915167NAC domain-containing protein 19
3swp_C5e-431315915167NAC domain-containing protein 19
3swp_D5e-431315915167NAC domain-containing protein 19
4dul_A4e-431315912164NAC domain-containing protein 19
4dul_B4e-431315912164NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1307314RRIRLKKE
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). Transcription factor involved in modulation of abscisic acid (ABA) signaling. Attenuates ABA sensitivity and glucose-induced ABA accumulation. Reduces the expression of ABI4 gene. {ECO:0000250|UniProtKB:Q949N0, ECO:0000269|PubMed:24625790}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010102025.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By glucose (PubMed:24625790). Induced by salt, drought stress and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:24625790}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024025054.10.0NAC domain-containing protein 60
SwissprotQ9LXL91e-89NAC60_ARATH; NAC domain-containing protein 60
TrEMBLW9RH240.0W9RH24_9ROSA; NAC domain-containing protein 89
STRINGXP_010102025.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73153346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44290.19e-89NAC domain containing protein 60
Publications ? help Back to Top
  1. Liang M, et al.
    Subcellular Distribution of NTL Transcription Factors in Arabidopsis thaliana.
    Traffic, 2015. 16(10): p. 1062-74
    [PMID:26201836]