PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010101901.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family ARR-B
Protein Properties Length: 654aa    MW: 71676.4 Da    PI: 5.9565
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010101901.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.47.8e-29204257155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kpr++W+ eLH++Fv av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  XP_010101901.1 204 KPRVVWSVELHQQFVAAVNQL-GIDKAVPKKILELMNVPGLTRENVASHLQKYRL 257
                     79*******************.********************************8 PP

2Response_reg75.81.6e-25261341109
                     EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTT CS
    Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaG 93 
                     vl+vdD+p+ +++l+++l+   y ev+ +  +e al ll+e++  +D+++ D+ mp+m+G++ll++i  e  +lp+i+++a + ++ + + +  G
  XP_010101901.1  26 VLVVDDDPTCLMILEKMLRTCLY-EVTKCNRAEHALSLLRENKngFDIVISDVHMPDMNGFKLLEHIGLEM-DLPVIMMSADDGKDVVMKGVTHG 118
                     89*********************.***************999999**********************6654.8********************** PP

                     ESEEEESS--HHHHHH CS
    Response_reg  94 akdflsKpfdpeelvk 109
                     a d+l Kp+ +e+l +
  XP_010101901.1 119 ACDYLIKPVRIEALKN 134
                     ************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363922.5E-1806646IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23006.2E-4223167No hitNo description
SuperFamilySSF521722.99E-3523147IPR011006CheY-like superfamily
SMARTSM004483.2E-3024136IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.31925140IPR001789Signal transduction response regulator, receiver domain
PfamPF000725.0E-2326134IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.94E-2727139No hitNo description
SuperFamilySSF466893.4E-20201261IPR009057Homeodomain-like
PROSITE profilePS5129411.048201260IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-30203262IPR009057Homeodomain-like
TIGRFAMsTIGR015579.3E-25204257IPR006447Myb domain, plants
PfamPF002499.3E-8206256IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009873Biological Processethylene-activated signaling pathway
GO:0010082Biological Processregulation of root meristem growth
GO:0010119Biological Processregulation of stomatal movement
GO:0010150Biological Processleaf senescence
GO:0071368Biological Processcellular response to cytokinin stimulus
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 654 aa     Download sequence    Send to blast
MATSTSGAAW KSGDVVSDQF PAGLRVLVVD DDPTCLMILE KMLRTCLYEV TKCNRAEHAL  60
SLLRENKNGF DIVISDVHMP DMNGFKLLEH IGLEMDLPVI MMSADDGKDV VMKGVTHGAC  120
DYLIKPVRIE ALKNIWQHVV RKKKNEWREL EQSGSVEEGD RSAKPSEDAD YSSSANEGNW  180
KSSKKRRDED EEAEERDDTS TLKKPRVVWS VELHQQFVAA VNQLGIDKAV PKKILELMNV  240
PGLTRENVAS HLQKYRLYLR RLSGQHQTSM NNSFINPQEA SFGAMTSLNG IDLQTLAVAG  300
QIPAQSLATL QAAGLGRSTA KPGIPLPLVD QRNLFSFENP KLRFGEGQQQ QQQHLGTSKP  360
VNLLHGIPTS MEPKQLTSLH QSAQSLGMNM QVNTHGAQNS SLLMQMNQPQ SRGQILNDTA  420
SSHVPRLPTT QTIVSTGLAS GVLGRNGITN NGRGAGYNPV MQNSSMLNFP NGFPLGSAST  480
MSGLPSQGSF QEEVTSEVKG SVSFAASYDI FNDLNQHKSN DWDIQNVGLT FDASQQSNSI  540
PSGSLDLVHQ GFSGSQRNMP VRNQSNVGKP MYSIGDIGHG NAQNTSQHLN TLLGDNSIRI  600
KTERNTDVLA DNGFFPEQFG QDDLMSALLK QQEGITPAEN QFDFDGYSMD NIPV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-22203263464ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Involved in the expression of nuclear genes for components of mitochondrial complex I. Promotes cytokinin-mediated leaf longevity. Involved in the ethylene signaling pathway in an ETR1-dependent manner and in the cytokinin signaling pathway. {ECO:0000269|PubMed:11370868, ECO:0000269|PubMed:11574878, ECO:0000269|PubMed:15282545, ECO:0000269|PubMed:16407152}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00054PBMTransfer from AT4G16110Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010101901.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010101901.10.0two-component response regulator ARR2 isoform X2
SwissprotQ9ZWJ90.0ARR2_ARATH; Two-component response regulator ARR2
TrEMBLW9RS740.0W9RS74_9ROSA; Two-component response regulator
STRINGXP_010101901.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39583458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.10.0response regulator 2
Publications ? help Back to Top
  1. Takahashi N, et al.
    Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots.
    Curr. Biol., 2013. 23(18): p. 1812-7
    [PMID:24035544]
  2. Ge XM, et al.
    Heterotrimeric G protein mediates ethylene-induced stomatal closure via hydrogen peroxide synthesis in Arabidopsis.
    Plant J., 2015. 82(1): p. 138-50
    [PMID:25704455]
  3. Takahashi N,Umeda M
    Cytokinins promote onset of endoreplication by controlling cell cycle machinery.
    Plant Signal Behav, 2014. 9(8): p. e29396
    [PMID:25763620]
  4. Kobayashi K, et al.
    Shoot Removal Induces Chloroplast Development in Roots via Cytokinin Signaling.
    Plant Physiol., 2017. 173(4): p. 2340-2355
    [PMID:28193764]
  5. Arnaud D, et al.
    Cytokinin-Mediated Regulation of Reactive Oxygen Species Homeostasis Modulates Stomatal Immunity in Arabidopsis.
    Plant Cell, 2017. 29(3): p. 543-559
    [PMID:28254779]
  6. Zhang TQ, et al.
    A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration.
    Plant Cell, 2017. 29(5): p. 1073-1087
    [PMID:28389585]
  7. Meng WJ, et al.
    Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL.
    Plant Cell, 2017. 29(6): p. 1357-1372
    [PMID:28576846]
  8. Zhang F,May A,Irish VF
    Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL.
    Trends Plant Sci., 2017. 22(10): p. 815-817
    [PMID:28886911]
  9. Takatsuka H,Higaki T,Umeda M
    Actin Reorganization Triggers Rapid Cell Elongation in Roots.
    Plant Physiol., 2018. 178(3): p. 1130-1141
    [PMID:30185441]