PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010101412.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family NAC
Protein Properties Length: 328aa    MW: 37458.6 Da    PI: 6.3145
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010101412.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.92.4e-50101381129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrF P+deelv++yL kk+ +++     ++ e+d++ +ePw+Lp+ +k + +ewyfFs rd+kyatg r+nrat+sgyWkatgkd++v+++
  XP_010101412.1  10 LPPGFRFYPSDEELVCHYLYKKICNEEALK-GTLVEIDLHICEPWQLPEVAKLNANEWYFFSFRDRKYATGYRTNRATTSGYWKATGKDRTVIDQ 103
                     79**********************999544.78***************88888999*************************************99 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrle 129
                      ++e vg++ktLvfy++rap+g kt W+mhe+rle
  XP_010101412.1 104 vTKEIVGMRKTLVFYRNRAPNGIKTGWIMHEFRLE 138
                     88899***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-608156IPR003441NAC domain
PROSITE profilePS5100557.110156IPR003441NAC domain
PfamPF023651.4E-2711137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MGLRDIGATL PPGFRFYPSD EELVCHYLYK KICNEEALKG TLVEIDLHIC EPWQLPEVAK  60
LNANEWYFFS FRDRKYATGY RTNRATTSGY WKATGKDRTV IDQVTKEIVG MRKTLVFYRN  120
RAPNGIKTGW IMHEFRLETP HMPPKEDWVL CRVFQKSKGS ENSNEEYYSP QLLLMDQNNT  180
SCAPPYSINL TSASSPPTDH QTTMPNSCGG CDQQIMTSFS STPTHHNHGT TSFLNRLHNF  240
SHDQKGASNY NPIIMATSAN NHHDNSNINI NSTTSPRNSS DVDYGFLWDT NFDENISSEN  300
NTNNHGGMLS NSNFDEMRFE IDNSMVFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-46916216171NO APICAL MERISTEM PROTEIN
1ut4_B1e-46916216171NO APICAL MERISTEM PROTEIN
1ut7_A1e-46916216171NO APICAL MERISTEM PROTEIN
1ut7_B1e-46916216171NO APICAL MERISTEM PROTEIN
4dul_A1e-46916216171NAC domain-containing protein 19
4dul_B1e-46916216171NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010101412.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010101412.10.0protein CUP-SHAPED COTYLEDON 3
TrEMBLW9RQU50.0W9RQU5_9ROSA; NAC domain-containing protein
STRINGXP_010101412.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43813359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.11e-93NAC domain containing protein 74