PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010101071.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family G2-like
Protein Properties Length: 483aa    MW: 51875.3 Da    PI: 8.2176
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010101071.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.64.9e-32292345255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  XP_010101071.1 292 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 345
                     9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.87E-15289345IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-28290345IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-23292345IPR006447Myb domain, plants
PfamPF002499.2E-7293344IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 483 aa     Download sequence    Send to blast
MPLEGIFIEP ASAAAASSAS TAVQQLPDLS LHISPPNNTS SSSSSSSSSA SPICEAAGDT  60
ARFDLLGRRP TAAADADYSS NSNNNKNLKA HTELSLGRLS FGTNGAGEPQ VPQNPYTNYQ  120
LHNHSHMRHI NRGGGGIDVA SASSDPFRPI KGIPVYSHNR SFPFLSAENG RDLHHHTHQV  180
INKDPKLCLY QMPNLSPSSP VLPSASSPYG LGGGGALDPM SILGSSNGSA YRVAAAARFN  240
GLAAAAEAFK STQLHHLHHQ YGQPHHHHHH EANSSRARFL PKLPTKRSMR APRMRWTSTL  300
HARFVHAVEL LGGHERATPK SVLELMDVKD LTLAHVKSHL QMYRTVKTTD KPAASSELGQ  360
SDGSGEDEMS QMGISGSDGT GGLLTHQFPE QKGPSDRSIQ SDNVDYKSAS LWSNSSSSRE  420
VWPQNNSRDI DALPLQSSVL SQQIQECDSS TRVKSYIGNN NFEGKNPSLE FTLGRPGWQG  480
GAI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-16293347458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-16293347458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-16293347357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-16293347357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-16293347357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-16293347357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-16293347458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-16293347458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-16293347458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-16293347458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-16293347458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-16293347458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010101071.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010101071.10.0transcription repressor KAN1 isoform X1
TrEMBLW9RMI30.0W9RMI3_9ROSA; Transcription repressor KAN1
STRINGXP_010101071.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.11e-65G2-like family protein