PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010099465.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family LBD
Protein Properties Length: 177aa    MW: 19532.1 Da    PI: 6.8938
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010099465.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260144.72.7e-4561051100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +Ca+Ck+lrr+CakdC++apyfpa++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql+ +la
  XP_010099465.1   6 PCASCKLLRRRCAKDCIFAPYFPADDPHKFAIVHKVFGASNVSKMLQELPAHQRGDAVSSLVYEANARVRDPVYGCVGAISYLQNQVSQLQMQLA 100
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_010099465.1 101 VAQAE 105
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.1255106IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-446103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MGGSSPCASC KLLRRRCAKD CIFAPYFPAD DPHKFAIVHK VFGASNVSKM LQELPAHQRG  60
DAVSSLVYEA NARVRDPVYG CVGAISYLQN QVSQLQMQLA VAQAEILCIQ MQQEPTLPTS  120
SHIIDQDDQK PFLNFNSNIS STNFSSNNIP QYLTFAANSS SSSNVMQDPL QRESLWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010099465.11e-131hypothetical protein L484_011165
SwissprotQ8LBW39e-84LBD12_ARATH; LOB domain-containing protein 12
TrEMBLW9RKL81e-131W9RKL8_9R
STRINGPOPTR_0001s28840.14e-95(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-82LBD family protein