PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010096790.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family TCP
Protein Properties Length: 282aa    MW: 28793.2 Da    PI: 10.468
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010096790.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP121.87.7e-3852135387
             TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsss 87 
                     +kk +++++h+kv+gR+RR+R+++ caar+F+L++eLG+++d++tieWLl+qa+p+i+++tgt++++as+++ +s s+ +++ ss
  XP_010096790.1  52 VKKPPSKDRHSKVDGRGRRIRMPIICAARVFQLTRELGHKSDGQTIEWLLRQAEPSIIAATGTGTTPASFST-VSVSVRGGARSS 135
                     79*****************************************************************97773.333333332222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136928.20957111IPR017887Transcription factor TCP subgroup
PfamPF036341.1E-3257134IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MSNSDVGASN GVNNGAIIEV QQGQQPMALA TVNNGTNGGK KGDGGNNGAL VVKKPPSKDR  60
HSKVDGRGRR IRMPIICAAR VFQLTRELGH KSDGQTIEWL LRQAEPSIIA ATGTGTTPAS  120
FSTVSVSVRG GARSSLAAST TSSSVSLEHK PLLGPTPFIL GKRLRPDEGG VKDGSDGNDG  180
VSVVGGTAMG SMVGSAAPAG GFWAPHFGQV WSFAAAAAPP EMVAQPSVSQ HQHAATSLFV  240
QQQAMGEASA ARLGNYLPGH LNLLASLSGG PGSSGRREDD PR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00524DAPTransfer from AT5G23280Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010096790.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010096790.10.0transcription factor TCP7
SwissprotQ9FMX22e-86TCP7_ARATH; Transcription factor TCP7
TrEMBLW9RD940.0W9RD94_9ROSA; Uncharacterized protein
STRINGXP_010096790.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54693153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23280.16e-54TCP family protein