PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010096550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family NAC
Protein Properties Length: 432aa    MW: 48729.6 Da    PI: 7.644
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010096550.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.97.9e-53211481128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     + pGfrFhPtdeelv +yLk+k+++++l++ e ik++diyk++PwdLpk ++++ekewyf+++rd+ky+++ r+nr+t++g+Wkatg+d++++s+
  XP_010096550.1  21 MLPGFRFHPTDEELVGFYLKRKIQQRPLSI-ELIKQLDIYKYDPWDLPKLASTGEKEWYFYCPRDRKYRNSARPNRVTRAGFWKATGTDRPIYSS 114
                     579***************************.89***************9888999***************************************9 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +++ +glkk+Lvfykgra kg+ktdW+mhe+rl
  XP_010096550.1 115 eGTKCIGLKKSLVFYKGRAAKGVKTDWMMHEFRL 148
                     56667***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.54E-5815181IPR003441NAC domain
PROSITE profilePS5100556.9221181IPR003441NAC domain
PfamPF023655.6E-2623148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0045770Biological Processpositive regulation of asymmetric cell division
GO:0048103Biological Processsomatic stem cell division
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 432 aa     Download sequence    Send to blast
MDHERSSTDH STDKVLVDEV MLPGFRFHPT DEELVGFYLK RKIQQRPLSI ELIKQLDIYK  60
YDPWDLPKLA STGEKEWYFY CPRDRKYRNS ARPNRVTRAG FWKATGTDRP IYSSEGTKCI  120
GLKKSLVFYK GRAAKGVKTD WMMHEFRLPS LTDHSVPSSK RSLDKSFPAN DSWAICRIFK  180
KTNSTAQRAL SHSWVSPLPE PISSSDHILF AKPTNNSQFS SETSINMSLT PRTSTPTSSA  240
NYFGSSNNDM QNSSPNSTTT TFSPVDFVPY KPYCADYSPN LLFPPLQTTS GVQAANDNIT  300
PSMLLNMSSI LGNNHFGCSS TSKASHHEDH IDLISGLSSV QEHCNSNGFS YDHILQENLG  360
NNIIGTYDHM IKNHSEAHHD QWEAVRSLGF PFNLPLPLST VVADPWKPSM IWDSLPCPTE  420
MSTNFPTTKC YT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-522318819171NO APICAL MERISTEM PROTEIN
1ut4_B1e-522318819171NO APICAL MERISTEM PROTEIN
1ut7_A1e-522318819171NO APICAL MERISTEM PROTEIN
1ut7_B1e-522318819171NO APICAL MERISTEM PROTEIN
3swm_A2e-522318822174NAC domain-containing protein 19
3swm_B2e-522318822174NAC domain-containing protein 19
3swm_C2e-522318822174NAC domain-containing protein 19
3swm_D2e-522318822174NAC domain-containing protein 19
3swp_A2e-522318822174NAC domain-containing protein 19
3swp_B2e-522318822174NAC domain-containing protein 19
3swp_C2e-522318822174NAC domain-containing protein 19
3swp_D2e-522318822174NAC domain-containing protein 19
4dul_A1e-522318819171NAC domain-containing protein 19
4dul_B1e-522318819171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010096550.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010096550.10.0putative NAC domain-containing protein 94
SwissprotQ9ZVH01e-107FEZ_ARATH; Protein FEZ
TrEMBLW9RCM80.0W9RCM8_9ROSA; Protein FEZ
STRINGXP_010096550.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20133490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-105NAC family protein
Publications ? help Back to Top
  1. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]