PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010095880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family HD-ZIP
Protein Properties Length: 377aa    MW: 41477.9 Da    PI: 6.6719
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010095880.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.78.3e-18216270256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ +++k+q   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  XP_010095880.1 216 RKKLRLSKDQSAFLEESFKEHNTLNPKQKIALAKQLNLRPRQVEVWFQNRRARTK 270
                     788899***********************************************98 PP

2HD-ZIP_I/II128.23.4e-41216306192
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     +kk+rlsk+q+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  XP_010095880.1 216 RKKLRLSKDQSAFLEESFKEHNTLNPKQKIALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELR-ALK 306
                     69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.02E-18207273IPR009057Homeodomain-like
PROSITE profilePS5007117.086212272IPR001356Homeobox domain
SMARTSM003898.0E-16214276IPR001356Homeobox domain
PfamPF000463.6E-15216270IPR001356Homeobox domain
CDDcd000865.46E-16216273No hitNo description
Gene3DG3DSA:1.10.10.603.4E-17221270IPR009057Homeodomain-like
PROSITE patternPS000270247270IPR017970Homeobox, conserved site
SMARTSM003409.1E-26272315IPR003106Leucine zipper, homeobox-associated
PfamPF021835.9E-11272306IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MELGLSLGDP PKPFGFLEKH QRENDNKSSA FCMDLSIGPS RTGEEGGGRA KEQEEPEELK  60
EKEQQGIRND VVCIAQIENV IGNDNKPGSS PPVQLDLLPL SPVPRTTTTT THGFPWSSSP  120
ADTAERGSGG LELNRIPKIT AAAAAAEEAA AEEGSSPNSN SGASSFPMEM CLYSSGNKNN  180
GNNNNYKRDQ YISEGEGERN SNSRASDEDE ANGANRKKLR LSKDQSAFLE ESFKEHNTLN  240
PKQKIALAKQ LNLRPRQVEV WFQNRRARTK LKQTEVDCEY LKRCCETLTE ENRRLHKELQ  300
ELRALKTSNP FYMQLPATTL TMCPSCERVA TTTTATTTAA AATNTSTNSN NTKDSKAVGG  360
FPLNRPKFYP FSHAQTT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1264272RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010095880.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010095880.10.0homeobox-leucine zipper protein HOX11
SwissprotP466651e-85HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLW9T1Y50.0W9T1Y5_9ROSA; Homeobox-leucine zipper protein HAT14
STRINGXP_010095880.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.18e-77homeobox from Arabidopsis thaliana