PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010094888.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family NAC
Protein Properties Length: 572aa    MW: 64398.5 Da    PI: 4.312
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010094888.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.45.8e-53191452128
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                     ppGfrFhPtdeelv +yLk+k+ gkkl+l ++i+e+d+yk +P++Lp+   +++++++w+fF +rd+ky++g r+nrat++gyWkatgkd++++s
  XP_010094888.1  19 PPGFRFHPTDEELVLYYLKRKICGKKLKL-NIIAETDVYKRDPEELPAlsILQTGDRQWFFFNPRDRKYPNGARSNRATRHGYWKATGKDRTITS 112
                     8****************************.89***************4447788999************************************** PP

             NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +++ vg+kktLvfy+grap+ge+tdWvmhey+l
  XP_010094888.1 113 -NSRSVGVKKTLVFYRGRAPNGERTDWVMHEYTL 145
                     .999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-5915168IPR003441NAC domain
PROSITE profilePS5100556.2918168IPR003441NAC domain
PfamPF023656.2E-2819145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 572 aa     Download sequence    Send to blast
MVSSEVSQVG GLGEEREWPP GFRFHPTDEE LVLYYLKRKI CGKKLKLNII AETDVYKRDP  60
EELPALSILQ TGDRQWFFFN PRDRKYPNGA RSNRATRHGY WKATGKDRTI TSNSRSVGVK  120
KTLVFYRGRA PNGERTDWVM HEYTLDEEEL KRCQDAQEYY ALYKVFKKSG PGPKNGEQYG  180
APFREEDWNH DCPDFDNSAN LEIPVEKVDE VLRNDNVKVD SQVPSFTFEE LMKDITEDSL  240
LDLAEVNVYA QTPSQVVCKE VKNTMVDPPH KEIIFHEPVN LFSVNGVQCN LQSSFDFTPP  300
AAELQVPVAP QIAADPIIHE QEIYILPEAD FLEMDDLLGP EPAQGTVEEA LHNVQVEEAD  360
GLSELDCYHD AAMFWNDIGP GTNEIIDQYE YYLDSNPFGP CEDVDQRYVE GESPTVNQMF  420
LNDANQVNYQ FQADGAPQAH EQEGSVLTSA EFYPGSNSDQ TSVNQNQNGN DDSGATTWFS  480
SAIWSFVESI PTNPASAAEN ALVNQALGRM PSFSRIRMNV MNTNTSAGSD SETTKSSCRK  540
RGFFFFPLLV AVIAIFWVVL GSVRLWGTGI TA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-501514512140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010094888.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010094888.10.0NAC domain-containing protein 17
TrEMBLW9QXU40.0W9QXU4_9ROSA; NAC domain-containing protein 78
STRINGXP_010094888.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61313451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-130NAC domain containing protein 17