PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010094751.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family NAC
Protein Properties Length: 338aa    MW: 37969.6 Da    PI: 8.29
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010094751.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.21.9e-5451311129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL++kv++  ++  ++++ vd++k+ePwdLp k++ +ekewyfFs +d+ky+tg r+nrat++gyWk+tgkdke+++ 
  XP_010094751.1   5 LPPGFRFHPTDEELITCYLARKVSDLGFTS-KAVAVVDLNKCEPWDLPDKASMGEKEWYFFSLKDRKYPTGLRTNRATEAGYWKTTGKDKEIFR- 97 
                     79*************************999.88***************988999****************************************. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                      g lvg+kktLvfykgrap+gek++Wvmheyrle
  XP_010094751.1  98 AGVLVGMKKTLVFYKGRAPRGEKSNWVMHEYRLE 131
                     999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.14E-623151IPR003441NAC domain
PROSITE profilePS5100558.9555151IPR003441NAC domain
PfamPF023653.1E-286130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MEETLPPGFR FHPTDEELIT CYLARKVSDL GFTSKAVAVV DLNKCEPWDL PDKASMGEKE  60
WYFFSLKDRK YPTGLRTNRA TEAGYWKTTG KDKEIFRAGV LVGMKKTLVF YKGRAPRGEK  120
SNWVMHEYRL ENKHPFKNTK EEWVVCRVFQ KSTAMKKPQQ AASSRDPSIE SPCDDGNSIA  180
NEYGDIELPN LNAIANSSSG GFLSNNNIIS TQGFLTNNNM MSLNNMNWTN SNPLPPLSSW  240
PSNLLSPNLS MNSFLLKALQ LRNSASTYTQ PSTDNYSYNM PQGVSHFGTD IHDLNTTTNF  300
KLGSSSSSSS KMMNSSKIVD SASQVQQQEQ PFNLDSVW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-56415716171NO APICAL MERISTEM PROTEIN
1ut4_B4e-56415716171NO APICAL MERISTEM PROTEIN
1ut7_A4e-56415716171NO APICAL MERISTEM PROTEIN
1ut7_B4e-56415716171NO APICAL MERISTEM PROTEIN
3swm_A5e-56415719174NAC domain-containing protein 19
3swm_B5e-56415719174NAC domain-containing protein 19
3swm_C5e-56415719174NAC domain-containing protein 19
3swm_D5e-56415719174NAC domain-containing protein 19
3swp_A5e-56415719174NAC domain-containing protein 19
3swp_B5e-56415719174NAC domain-containing protein 19
3swp_C5e-56415719174NAC domain-containing protein 19
3swp_D5e-56415719174NAC domain-containing protein 19
4dul_A4e-56415716171NAC domain-containing protein 19
4dul_B4e-56415716171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010094751.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010094751.10.0protein CUP-SHAPED COTYLEDON 1
TrEMBLW9QX190.0W9QX19_9ROSA; Protein CUP-SHAPED COTYLEDON 2
STRINGXP_010094751.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49463356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.11e-109NAC domain containing protein 58