PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010094493.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family SBP
Protein Properties Length: 1042aa    MW: 115134 Da    PI: 8.2952
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010094493.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.99.3e-41128205178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +Cqv++C++dls+ak+yhrrhkvCe hsk++++lv++++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+q+
  XP_010094493.1 128 MCQVDNCKEDLSNAKDYHRRHKVCELHSKSTKALVAQQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQP 205
                     6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.6E-34122190IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.821126203IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.88E-37127207IPR004333Transcription factor, SBP-box
PfamPF031101.8E-29129202IPR004333Transcription factor, SBP-box
CDDcd002045.80E-4846939No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1042 aa     Download sequence    Send to blast
MEEVGAQVAA PIFIHQTLTS RYRDAPPVMT AAKKRDLPYH PTPNFQQNWN PKLWDWDAVR  60
FVAKPLDSDE KKRQEQAPVA AGHEDDERLR LNLGCGLISA ARSEEPAVVS RPTKRVRSGS  120
PGNSTYPMCQ VDNCKEDLSN AKDYHRRHKV CELHSKSTKA LVAQQMQRFC QQCSRFHPLS  180
EFDEGKRSCR RRLAGHNRRR RKTQPEDVAS RLILPGDRDN RSNGHIDIFN LLAAVARAQG  240
KNEEKNISCS QLPDKEQLLQ ILSKINSLPL PVDLAAKLHD LASLNRKISE QTSSDHHEKL  300
NGRTSQSTMD LLAVLSATLA PSAPDSLAVL SQRSSYSSDS GKTKMNCNDQ ASGPILQKQS  360
PQEFPSVGGD RSSTSYQSPM EDSDCQVQET RVNLPLQLFS SSPENDSPPK LASSRKYFSS  420
DSSNPIEERS PSSSPVVQKL FPMQTMAETV KSEKISAGRE VNVHVDSSRI HGCNMPFDLF  480
GGSNKGNDAG STLSVPHHAG YTSSGSDHSP SSLNSDVQDR TGRIMFKLFN KDPSHLPGTL  540
RTQIFNWLSN SPSEMESYIR PGCVIISVYV SMPSSAWEQL QDNLLQHLNS LVQSSASDFW  600
RSGRFLVHTG RQIASHKDGK VRISKSWSTW SSPELISVSP LAIVGGQETT LILKGRNLSN  660
LGTKIHCTYM GGYTTKEVTG STSHGTMYEE INLCGFKIHD ASPGVLGRCF IEVENGLKGN  720
SFPVIVADAS ICQELRILES VFDGKAKVSE VIAEDQNADE GRPRSKEEVL LFLNELGWLF  780
QRKRASSIPD GPDYSLGRFK FLLTFSVDKN CSALIKTLLD MLIERNLDGN ELSGDAVEML  840
SEIQLLHRAV KRRCRKMVDL LINYSVIGSN FVSKKYIFPP NHAGPGCITP LHLAACMSAS  900
DDLIDALTND PQEIGFNSWN SLLDANGQSP YAYALMTNNQ SYNMLVARKL AEKISGQITV  960
TIGNGMSTEF KQSRKSCAKC AVAATRHYKR VPGAQGLLQR PYVHSMLAIA AVCVCVCLFL  1020
RGLPDIGSVA PFKWENLDYG TI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-31119202184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1847852RAVKRR
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010094493.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010094493.10.0squamosa promoter-binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLW9R6Y20.0W9R6Y2_9ROSA; Squamosa promoter-binding-like protein 14
STRINGXP_010094493.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]