PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010093981.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family VOZ
Protein Properties Length: 445aa    MW: 50019.8 Da    PI: 5.506
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010093981.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ408.21.6e-1252034291217
             VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaael 95 
                     ppp+aflgpkcalwdc+rpaqgs+w+qdycss+ha+lalneglpg+tpvlrp g+d+kdg+lf+al+ k++gkevgip+cegaa +k+pwna++l
  XP_010093981.1 203 PPPAAFLGPKCALWDCSRPAQGSKWCQDYCSSCHAVLALNEGLPGITPVLRPSGLDVKDGPLFSALNLKTNGKEVGIPNCEGAAFTKCPWNAPDL 297
                     89********************************************************************************************* PP

             VOZ  96 fdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklv 190
                     fdlsllege irewlffdkprrafesgnrkqrslpdy+grgwhesrkq+mkefgg+krsyymdpqps+ +ewhlyey+i+++ ++alyrlelklv
  XP_010093981.1 298 FDLSLLEGEKIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQIMKEFGGQKRSYYMDPQPSTLHEWHLYEYDITNYSTCALYRLELKLV 392
                     *********************************************************************************************** PP

             VOZ 191 dekksakgk..........vskdsladlqkklgrlta 217
                     de+ks+k k          vs+dsladlqkk+grlta
  XP_010093981.1 393 DERKSPKVKgdgkkslkgnVSNDSLADLQKKMGRLTA 429
                     99988865444445555559***************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    Send to blast
MDRRGFEATG SMQKDSKGKC ETASHHNLKE KTKNRVDDLQ RMFSNLESAR KERRTGDVAV  60
FEEQVNQMLR EWKVELSEPS PASSLLGGSF GSFSEELARL LQDDATSPLG DLTLPKPKPD  120
PDLEDFAFAQ EPQDQSFQGF YEPKGTSLDF HDVMANDSHL STQLEHHQFD LHQDFNEGHF  180
VGNISNDQYG QDALTEVLPD ISPPPAAFLG PKCALWDCSR PAQGSKWCQD YCSSCHAVLA  240
LNEGLPGITP VLRPSGLDVK DGPLFSALNL KTNGKEVGIP NCEGAAFTKC PWNAPDLFDL  300
SLLEGEKIRE WLFFDKPRRA FESGNRKQRS LPDYNGRGWH ESRKQIMKEF GGQKRSYYMD  360
PQPSTLHEWH LYEYDITNYS TCALYRLELK LVDERKSPKV KGDGKKSLKG NVSNDSLADL  420
QKKMGRLTAE APGDDSNTYR GSADR
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010093981.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024019795.10.0transcription factor VOZ1 isoform X1
SwissprotQ9SGQ01e-164VOZ1_ARATH; Transcription factor VOZ1
TrEMBLW9QVA90.0W9QVA9_9ROSA; Uncharacterized protein
STRINGXP_010093981.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14983494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-147vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]