PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010093764.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family NAC
Protein Properties Length: 271aa    MW: 30266.4 Da    PI: 4.8003
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010093764.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM133.11.9e-4141343128
             NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleev.ikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     pGfrF Pt+eelvv+yL +k+e+++ e+ +  i+e++iy++ PwdLp+     ++++ ++++fF++r++++a+g r++r t+ gyWkatg+   v
  XP_010093764.1   4 PGFRFYPTEEELVVFYLPNKIERTREEVMDKvIPELNIYDYSPWDLPQysgvLCRGDPEQCFFFIPRQESEARGGRPSRLTEGGYWKATGSPSFV 98 
                     9**********************997765544***************64665444566799********************************** PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +s++++++glk+t+vfy+grap+g+kt+W ++ey++
  XP_010093764.1  99 FSSNNQTIGLKRTMVFYTGRAPNGVKTQWKINEYKA 134
                     **********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100545.1992171IPR003441NAC domain
SuperFamilySSF1019413.92E-444171IPR003441NAC domain
PfamPF023657.6E-204133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MEIPGFRFYP TEEELVVFYL PNKIERTREE VMDKVIPELN IYDYSPWDLP QYSGVLCRGD  60
PEQCFFFIPR QESEARGGRP SRLTEGGYWK ATGSPSFVFS SNNQTIGLKR TMVFYTGRAP  120
NGVKTQWKIN EYKATQGDQP SSISSTGASA STSTTTPMLR QEFSLCRVYK KTKCLRAFDR  180
RPAGMEITIS NNPAINLQYD RPEEPSTLSH QAPPPAAAER GGSHDDSSSS GGGGGGGDGG  240
YQPSQTGEND YLNFPMDTDE SQALWDWDHF F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-29417117168Stress-induced transcription factor NAC1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010093764.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010093764.10.0NAC domain-containing protein 90 isoform X1
TrEMBLW9QUN90.0W9QUN9_9ROSA; NAC domain-containing protein 90
STRINGXP_010093764.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87134123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.14e-69NAC domain containing protein 90