PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010093594.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family NAC
Protein Properties Length: 357aa    MW: 40285.3 Da    PI: 9.0124
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010093594.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.64e-56161421129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL kkv ++++ + ++i evd++k+ePwdLp k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++ 
  XP_010093594.1  16 LPPGFRFHPTDEELISHYLYKKVVDTNFAC-RAIGEVDLNKSEPWDLPWKAKMGEKEWYFFCVRDRKYPTGLRTNRATEAGYWKATGKDKEIYR- 108
                     79*************************999.89***************888999****************************************. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                     +++lvg+kktLvfykgrapkgek++Wvmheyrle
  XP_010093594.1 109 GKSLVGMKKTLVFYKGRAPKGEKSNWVMHEYRLE 142
                     999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-6413166IPR003441NAC domain
PROSITE profilePS5100559.67516166IPR003441NAC domain
PfamPF023652.7E-2917141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MENVLGQVKE DDQLDLPPGF RFHPTDEELI SHYLYKKVVD TNFACRAIGE VDLNKSEPWD  60
LPWKAKMGEK EWYFFCVRDR KYPTGLRTNR ATEAGYWKAT GKDKEIYRGK SLVGMKKTLV  120
FYKGRAPKGE KSNWVMHEYR LEGKFSVHNL PKTAKNEWVI CRVFQKSSGG KKIPIAGFSR  180
LGPFGNEIGS FGLPPLMDSS SPFNNKPRNV SDSANVPCFS NPSMLVIDNN NNANNDNSNN  240
NNPIFGVPSN PTNNVIIPRI ALSNPLYPTQ SGPVSSYMQF QSQVLVHDQS ILSALLNNNG  300
SSLRQSFKAE RQQETTTAND HISNEITSVM ANLEMGRRQF GDQNQSGPVD LESFWNY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-5581726171NO APICAL MERISTEM PROTEIN
1ut4_B2e-5581726171NO APICAL MERISTEM PROTEIN
1ut7_A2e-5581726171NO APICAL MERISTEM PROTEIN
1ut7_B2e-5581726171NO APICAL MERISTEM PROTEIN
4dul_A2e-5581726171NAC domain-containing protein 19
4dul_B2e-5581726171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010093594.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010093594.10.0NAC domain-containing protein 100
SwissprotQ9FLJ21e-147NC100_ARATH; NAC domain-containing protein 100
TrEMBLW9QTW90.0W9QTW9_9ROSA; NAC domain-containing protein 100
STRINGXP_010093594.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-141NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]