PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010092473.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family NAC
Protein Properties Length: 349aa    MW: 39765 Da    PI: 4.5715
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010092473.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.87.1e-5661331128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFhPtdeelv +yL +k++g+++el e+i+evd+yk+ePwdLp k  + +++ ewyf+s+rd+ky++g+r+nrat++gyWkatgkd++v 
  XP_010092473.1   6 LPPGFRFHPTDEELVAYYLDRKITGQTIEL-EIIPEVDLYKCEPWDLPdKsYLPSKDMEWYFYSPRDRKYPNGSRTNRATRAGYWKATGKDRPVQ 99 
                     79****************************.99**************95335666888************************************9 PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +++ vg+kktLv+y+grap+g +t+Wvmheyrl
  XP_010092473.1 100 P-QRRPVGMKKTLVYYRGRAPHGIRTNWVMHEYRL 133
                     9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.42E-643158IPR003441NAC domain
PROSITE profilePS5100560.6836158IPR003441NAC domain
PfamPF023657.6E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MAPMSLPPGF RFHPTDEELV AYYLDRKITG QTIELEIIPE VDLYKCEPWD LPDKSYLPSK  60
DMEWYFYSPR DRKYPNGSRT NRATRAGYWK ATGKDRPVQP QRRPVGMKKT LVYYRGRAPH  120
GIRTNWVMHE YRLIEDSLSG AASSTLKDSY ALCRVFKKTI QIPKSNKDEK SNNSAKTEKE  180
SAATANESSG GFDQISRGTE NEDDQNFNND YFPNKTLFPS ETSSSDLTQG TPTETGVADD  240
LQAPFASDNE ANSTADLYSY GVDCSSNLIE EIQMSNYESL HYQLAYPPLE LEDFPQINLG  300
EMKLLKSETT EECMSYDKFR DYMNGTVEDI FSLCSSSHEN SIPLPMQEN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-59115812165NO APICAL MERISTEM PROTEIN
1ut4_B7e-59115812165NO APICAL MERISTEM PROTEIN
1ut7_A7e-59115812165NO APICAL MERISTEM PROTEIN
1ut7_B7e-59115812165NO APICAL MERISTEM PROTEIN
3swm_A7e-59115815168NAC domain-containing protein 19
3swm_B7e-59115815168NAC domain-containing protein 19
3swm_C7e-59115815168NAC domain-containing protein 19
3swm_D7e-59115815168NAC domain-containing protein 19
3swp_A7e-59115815168NAC domain-containing protein 19
3swp_B7e-59115815168NAC domain-containing protein 19
3swp_C7e-59115815168NAC domain-containing protein 19
3swp_D7e-59115815168NAC domain-containing protein 19
3ulx_A7e-59215811168Stress-induced transcription factor NAC1
4dul_A7e-59115812165NAC domain-containing protein 19
4dul_B7e-59115812165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00205DAPTransfer from AT1G54330Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010092473.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010092473.10.0NAC domain-containing protein 86
TrEMBLW9RD250.0W9RD25_9ROSA; NAC domain-containing protein 78
STRINGXP_010092473.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF105083341
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54330.11e-109NAC domain containing protein 20