PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010091609.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family SBP
Protein Properties Length: 496aa    MW: 55219.6 Da    PI: 7.1074
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010091609.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.81.2e-41153228277
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                     Cqv+gC++dl++ k+yh++h+vC+vhsk+++v+v+g+eqrfCqqCsrfh+l efD++krsCrrrLa+hnerrrk+q
  XP_010091609.1 153 CQVHGCNMDLTSSKDYHKKHRVCDVHSKTAKVIVNGIEQRFCQQCSRFHMLAEFDDGKRSCRRRLAGHNERRRKPQ 228
                     **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.0E-33146214IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.616150227IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.28E-39151231IPR004333Transcription factor, SBP-box
PfamPF031102.8E-31153226IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 496 aa     Download sequence    Send to blast
MESWNFASEE LDWSDAFART RRALIQCENG FIPNRESAES FESTELGLPE MFRRTIQSSN  60
EMFCGGGGGD FGTLISPNSS LVEEESGSKV SGSLMESNNS QDSSLIALKL GGGEGSKERS  120
HSHSHSNSHH QVSSSMAAKR ARTRGSYSQT PFCQVHGCNM DLTSSKDYHK KHRVCDVHSK  180
TAKVIVNGIE QRFCQQCSRF HMLAEFDDGK RSCRRRLAGH NERRRKPQLD GLSDKAHKLS  240
HPYHGNRYMG TSMQKRTPFV FSDILPGVVL SPDKYEQVNQ FGDIKFEDEP IYNPQLTVPI  300
MSSQLLSKSF IHPIGIGKQH SSGIPTSETH DYCFHTTAGI QKLSGASQST CALSLLSSQS  360
QHLHSTGIPS PSPMIMQGAH QTVGHLLDKP LRLRSMERHG GANGFYSCAM NPVGVVEQFE  420
STMFSEANPA VDFEVHDADR AFQDSHNLQT KYCLAPEHGS TVDLLQLSSH LQRVEHQRNF  480
MQVKQENEDF CCFPTA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-281522261084squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010091609.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010091609.10.0squamosa promoter-binding-like protein 6
RefseqXP_024018257.10.0squamosa promoter-binding-like protein 6
RefseqXP_024018258.10.0squamosa promoter-binding-like protein 6
TrEMBLW9QNN50.0W9QNN5_9ROSA; Squamosa promoter-binding-like protein 6
STRINGXP_010091609.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.12e-48SBP family protein