PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010091553.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family HD-ZIP
Protein Properties Length: 860aa    MW: 93401.6 Da    PI: 6.0778
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010091553.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.14.9e-21149204156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++ +++t++q++eLe+lF+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
  XP_010091553.1 149 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMK 204
                     688999***********************************************999 PP

2START201.92.6e-633565831206
                     HHHHHHHHHHHHHHHHC-TT-EEEE.......EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
           START   1 elaeeaaqelvkkalaeepgWvkss.......esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                     ela++a++elvk+a+ +ep+W +s        e +n +e+l++f++  +       +ea+r++g+v+ ++  lve+l+d++ +W e ++    + 
  XP_010091553.1 356 ELALAAMDELVKMAQTDEPLWIRSLegggggrEVLNHEEYLRSFTPCIGmkpngLVTEASRETGIVIINSLALVETLMDSN-RWAEIFPcmiaRT 449
                     5899*****************************************99989*******************************.************* PP

                     EEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEE CS
           START  80 etlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwv 167
                     +t++vissg      galqlm aelq+lsplvp R++ f+R+++q+++g+w++vdvS+d  ++ +  + +v +++lpSg+++++++ g+skvtwv
  XP_010091553.1 450 STTDVISSGmggtrnGALQLMHAELQVLSPLVPvREVNFLRFCKQHSEGVWAVVDVSIDTIRETSGAPTFVNCRRLPSGCVVQDMPSGYSKVTWV 544
                     ***************************************************************999***************************** PP

                     E-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 168 ehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     eh++++++++h+l+r+l++sg+ +ga++wvatlqrqce+
  XP_010091553.1 545 EHAEYDESQVHQLYRPLLSSGMGFGAQRWVATLQRQCEC 583
                     *************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.67E-20134206IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-21136206IPR009057Homeodomain-like
PROSITE profilePS5007117.216146206IPR001356Homeobox domain
SMARTSM003899.9E-18147210IPR001356Homeobox domain
CDDcd000861.43E-18148206No hitNo description
PfamPF000461.5E-18149204IPR001356Homeobox domain
PROSITE patternPS000270181204IPR017970Homeobox, conserved site
PROSITE profilePS5084844.77347586IPR002913START domain
SuperFamilySSF559617.14E-34349583No hitNo description
CDDcd088753.45E-123351582No hitNo description
SMARTSM002342.6E-49356583IPR002913START domain
PfamPF018521.9E-55356583IPR002913START domain
SuperFamilySSF559612.64E-23612783No hitNo description
SuperFamilySSF559612.64E-23813853No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 860 aa     Download sequence    Send to blast
MSFGGFLDNS STGGGGVGGG SRIVADIPYS NNNHNHNNEN DNNHINNDNN NMPSTAIAQP  60
RLVTQSLTKS MFNSPGLSLA LGFVLHCFVE QQTNIDGQGD MIRNMAENFE PSGGRRSREE  120
EHEISRSGSD NLEGGSGDDQ DAADKPPRKK RYHRHTPQQI QELEALFKEC PHPDEKQRLE  180
LSKRLCLETR QVKFWFQNRR TQMKTQLERH ENSLLRQEND KLRAENMSIR DAMRNPICTN  240
CGGPAIIGEI SFEEQHLRIE NARLKDELER VCALAGKFLG RPISSLATSL APPLPSSALE  300
LGVGSNGFAA LSATTMPLGP DFGGGISNPL PVLPPARPTG GVQVLDRSIE RSMYLELALA  360
AMDELVKMAQ TDEPLWIRSL EGGGGGREVL NHEEYLRSFT PCIGMKPNGL VTEASRETGI  420
VIINSLALVE TLMDSNRWAE IFPCMIARTS TTDVISSGMG GTRNGALQLM HAELQVLSPL  480
VPVREVNFLR FCKQHSEGVW AVVDVSIDTI RETSGAPTFV NCRRLPSGCV VQDMPSGYSK  540
VTWVEHAEYD ESQVHQLYRP LLSSGMGFGA QRWVATLQRQ CECLAILMSS TVPTRDHTAG  600
ITASGRRSML KLAQRMTDNF CAGVCASTVH KWNKLNATGN VDEDVRVMTR KSVDDPGEPP  660
GIVLSAATSV WLPVSPNRLF DFLRDERLRS EWDILSNGGP MQEMAHIAKG QDHGNCVSLL  720
RASAMNTNQS SMLILQETCI DAAGSLVVYA PVDIPAMHVV MNGGDSAYVA LLPSGFSIVP  780
DGPGSRGSVS ATTNGGGNNV NNVNGGDGPQ RVGGSLLTVA FQILVNSLPT AKLTVESVET  840
VNNLISCTVQ KIKAALHCES
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010091553.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024018220.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLW9QYS70.0W9QYS7_9ROSA; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
STRINGXP_010091553.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]