PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010091523.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family Nin-like
Protein Properties Length: 345aa    MW: 39963 Da    PI: 5.6115
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010091523.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK78.76.5e-25161210352
          RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     k +s e lsky+++pi++AAkeL+v+lT+LK++CR++GI+RWPhRk+ sl
  XP_010091523.1 161 KMLSRELLSKYYYMPITQAAKELNVGLTLLKKRCRELGISRWPHRKLISL 210
                     78999*****************************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.154148230IPR003035RWP-RK domain
PfamPF020421.3E-20163210IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
METCWTMSNY EILAIDENPF MFPISQLPPF DFSGEYAGYY NNINLEYNWQ NELPIQESFL  60
LDAVPLMEYH SSTDHSFYGT MEPISTVIQD HEFFYGNGNG PALGVWDQDG RVGFGPEIHV  120
QQKPINHNGE TGKYLMTKEE RKGVKRCRSS SEEKNSNSTS KMLSRELLSK YYYMPITQAA  180
KELNVGLTLL KKRCRELGIS RWPHRKLISL QTLINNVQEL VKQEGVENES KLKNAIELLE  240
REKKLVEEVP DIQLEDTTKR LRQACFKANY KKRKLRIMES HESDFNKGKS SPHQYHHHHE  300
TMFCSSSSSS AYQIITVDQE EEDDQEVIKS LLSEDSFSSG NLLMF
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010091523.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024018219.10.0protein RKD2
TrEMBLW9QYQ30.0W9QYQ3_9ROSA; Uncharacterized protein
STRINGXP_010091523.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.13e-47RWP-RK domain-containing protein