PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010091182.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family GRF
Protein Properties Length: 485aa    MW: 52923.6 Da    PI: 7.5167
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010091182.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.51.3e-24157200144
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     d+epgrC+RtDGKkWRCsr+v +++k+CErH+hrgr rsrk++e
  XP_010091182.1 157 DPEPGRCKRTDGKKWRCSRDVAPDQKYCERHMHRGRPRSRKHVE 200
                     79****************************************97 PP

2QLQ56.48.8e-2097132237
             QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                     +FT+aQ+ +L++Q+++yKy++a++PvP +Ll++i++
  XP_010091182.1  97 PFTNAQWKELERQAMIYKYMVASVPVPLDLLLPITN 132
                     8*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.2E-1096132IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.4E-1397130IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.89297132IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.325157201IPR014977WRC domain
PfamPF088791.5E-20158200IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 485 aa     Download sequence    Send to blast
MMMMRVHDDD RVHDNQHRQF PSSQRGEADG PTTTTTPRLP PRTNDIYDIV GSRIDHVFVS  60
GGCSAPLQQP FHTRASTSTS IYSTAFNKSS GESIGFPFTN AQWKELERQA MIYKYMVASV  120
PVPLDLLLPI TNRNLCPSSS PLVNGGELKL RFSNGADPEP GRCKRTDGKK WRCSRDVAPD  180
QKYCERHMHR GRPRSRKHVE LHVNNSNNNN ATSNKRTRLD HHHHNHQNSN NGSATTLSSS  240
NFLGGSALLP YHPSPVFESL PSHLSSDKEP RSLEWMMKGG EHVPMATSSD PTWLHLMNHT  300
KLEMTSKPSS MEEPFLNLNS YANFTTGEEH ENDRDCALFL NPDNVVSDPP RSFIDAWSSQ  360
TQESNHQVKK LSPSSSSSLT LSMGNNNNDK SPSCSWLSPP LTSSWVGSPL GGPLGEVLRP  420
STASDPPSPF TGNGDSGSPP ATVASSPSGV LQKTLNAASL SDSSGCSSSS LALGSSNAKP  480
EISLL
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010091182.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0944811e-34EU094481.1 Amaranthus hypochondriacus clone AHAAC006 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010091182.10.0growth-regulating factor 2
TrEMBLW9QMM80.0W9QMM8_9ROSA; Uncharacterized protein
STRINGXP_010091182.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73242842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.12e-38growth-regulating factor 7