PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010091043.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family LBD
Protein Properties Length: 306aa    MW: 34393.3 Da    PI: 5.6416
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010091043.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.55.2e-39101091100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++rr+C+++C lapyfp +qpk f+n+hklFG++n+lk+l++l++e++ +am s++yeA+ r rdP +G++g i +l+ q+ +l++el+
  XP_010091043.1  10 ACAACKYQRRRCTAECLLAPYFPPDQPKIFQNAHKLFGVKNILKILEKLDPEQKAAAMWSIIYEANERDRDPAHGCLGKICQLRYQIWHLEQELH 104
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     +++++
  XP_010091043.1 105 SVHTH 109
                     99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.3789110IPR004883Lateral organ boundaries, LOB
PfamPF031955.8E-3710107IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MTLKGGTSQA CAACKYQRRR CTAECLLAPY FPPDQPKIFQ NAHKLFGVKN ILKILEKLDP  60
EQKAAAMWSI IYEANERDRD PAHGCLGKIC QLRYQIWHLE QELHSVHTHL EICRQHHHQQ  120
QQISSNMPHH DQHVTSQLER GMAPPSNALP LLSDHTTAQA YNAMPGLAVT QHEAYSNNTN  180
DAYDAVVFMD SKDNNNVGNP LWAQYPYSTT NNSENNNNSS MAIQSQMVVS QPLDVQQQVV  240
QDCDEMPFFM DDRQSFADSK EAYESSSEES VLKDTTQSLD PVADIELKNA AACFSLTSVT  300
AATDHK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-3161287127LOB family transfactor Ramosa2.1
5ly0_B2e-3161287127LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010091043.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010091043.10.0LOB domain-containing protein 27
TrEMBLW9QM940.0W9QM94_9ROSA; Uncharacterized protein
STRINGXP_010091043.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.13e-50LOB domain-containing protein 27