PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010090859.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family NAC
Protein Properties Length: 381aa    MW: 42832.8 Da    PI: 4.5648
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010090859.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1622.2e-5061331128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     l pGfrFhPtd elv++yLk+k+ g+kl++ e+i+evdiyk+ PwdLp k ++++++ +wyfF++r+kkya+g r +rat+ gyWk+tgkd++v 
  XP_010090859.1   6 LSPGFRFHPTDVELVKYYLKRKILGRKLHF-EAISEVDIYKYAPWDLPdKaCLDSKDLKWYFFCPREKKYASGARMKRATEFGYWKTTGKDRPVN 99 
                     579*************************99.89**************96346777778************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +ge+vg+ ktLvf++grapkg +tdWvmhey l
  XP_010090859.1 100 Y-NGEVVGMIKTLVFHTGRAPKGDRTDWVMHEYML 133
                     9.999****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.89E-584156IPR003441NAC domain
PROSITE profilePS5100555.036156IPR003441NAC domain
PfamPF023659.8E-268132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MGKTLLSPGF RFHPTDVELV KYYLKRKILG RKLHFEAISE VDIYKYAPWD LPDKACLDSK  60
DLKWYFFCPR EKKYASGARM KRATEFGYWK TTGKDRPVNY NGEVVGMIKT LVFHTGRAPK  120
GDRTDWVMHE YMLQEKNLAD RGVVQDSYVL CMVFKKEGPG PRNGAQYGAP FREEDWTDHE  180
EDNCAEVGPS AIVTFQNNLL PNRNLVACNS HTLESTGNVF SPESCVSDMV PPSSEVTLPV  240
SANDDPVERV ESFDDDDILE MLGYFIEGEP FEVNGNNQNK DANNVNHVDP ATVAAPHDGT  300
DIFKDLADLD NLAYGFHFSN AHITPSFDEA FPTGDDRSFL ELVDLDAPLS RPAGASEDDI  360
NTFPAVQLSM WPHTAHNLDG F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-45615715169Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that binds specific DNA sequences on the promoter regions of target genes. {ECO:0000250|UniProtKB:Q9C8W9}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010090859.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010090859.10.0NAC domain-containing protein 82
RefseqXP_024017752.10.0NAC domain-containing protein 82
SwissprotQ9FY821e-100NAC82_ARATH; NAC domain-containing protein 82
TrEMBLW9QLV40.0W9QLV4_9ROSA; NAC domain-containing protein 78
STRINGXP_010090859.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33023465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09330.41e-102NAC domain containing protein 82
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Deeken R, et al.
    Identification of Arabidopsis thaliana phloem RNAs provides a search criterion for phloem-based transcripts hidden in complex datasets of microarray experiments.
    Plant J., 2008. 55(5): p. 746-59
    [PMID:18485061]
  3. Ohbayashi I, et al.
    Evidence for a Role of ANAC082 as a Ribosomal Stress Response Mediator Leading to Growth Defects and Developmental Alterations in Arabidopsis.
    Plant Cell, 2017. 29(10): p. 2644-2660
    [PMID:28899981]