PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010090439.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family NAC
Protein Properties Length: 612aa    MW: 68034.7 Da    PI: 4.4086
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010090439.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.13e-5291361128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     l+pGfrFhPtdeelv +yLk+kv g++l++ + i+ vd+yk+ePwdLp k k+k+++ ewyfFs  dkky +++r+nrat +gyWk+tgkd+++ 
  XP_010090439.1   9 LAPGFRFHPTDEELVRYYLKRKVCGRPLRI-DPISVVDVYKSEPWDLPdKsKLKTRDLEWYFFSALDKKYGNSSRTNRATVEGYWKTTGKDRPIR 102
                     579***************************.89**************95347777888************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + ++++vg+kktLv+++grapkg +t+Wvmheyrl
  XP_010090439.1 103 Q-SSRTVGMKKTLVYHSGRAPKGARTNWVMHEYRL 136
                     9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.37E-617159IPR003441NAC domain
PROSITE profilePS5100557.5149159IPR003441NAC domain
PfamPF023651.7E-2711136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 612 aa     Download sequence    Send to blast
MGRDSSTSLA PGFRFHPTDE ELVRYYLKRK VCGRPLRIDP ISVVDVYKSE PWDLPDKSKL  60
KTRDLEWYFF SALDKKYGNS SRTNRATVEG YWKTTGKDRP IRQSSRTVGM KKTLVYHSGR  120
APKGARTNWV MHEYRLADEE LEKAGIAQDA FVLCRIFQKS GTGPKNGEQY GAPFIEEEWE  180
DDEIVAMVPG EETPTGEVEV DDSAFVDVNE LDQELFIVTI VHRRDGKHLA TVFETNALFS  240
QNFGTGIPLE VDAVPFTFYH GDTSNNVEHA GNFADPDTSE VAPLPLNYYH GETSNYVEHS  300
GDFSEGDLKP MIGMENSEIG VEQPFFRLPE QHEMHAKPVK DEYCVQPSDN VDPADVNYAF  360
GEQFLNATNT PPFGEGLYLE TNDLSKPVEE DPGDFGLLDE YLNFFDVEDD SQLLAFDSSQ  420
IMGIENSLTQ EEPPLQKLVT GEAEASPTGT QQPAEAHDNN EASTSSQRAE VTKSESDFKY  480
PFMKQASQML GSIPAPPAFA AEFPTKDAAL RLNSVGTSSG SVHVTAGMIR IQHLNLDGNG  540
MDWSFGKSGD VNLLLSYSLP QAAFDSATVV PMAGILSGKA GSVVSKGWFF FMFIWVLIIS  600
VSFKVGNYIY TR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-48415910168Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBMTransfer from AT5G04410Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010090439.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR0600160.0KR060016.1 Morus alba NAC domain containing transcription factor 78-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024017429.10.0NAC domain-containing protein 53
TrEMBLW9QKP70.0W9QKP7_9ROSA; NAC domain-containing protein 78
STRINGXP_010090439.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53473247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.11e-157NAC domain containing protein 2