PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010089952.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family ARR-B
Protein Properties Length: 674aa    MW: 74487.7 Da    PI: 6.0699
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010089952.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.82.5e-28206259155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kpr++W+ eLH++Fv av+qL G++kA+Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  XP_010089952.1 206 KPRVVWSVELHRKFVAAVNQL-GIDKAVPKKILDLMNVEKLTRENVASHLQKYRL 259
                     79*******************.********************************8 PP

2Response_reg76.31.1e-25201281109
                     EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTT CS
    Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaG 93 
                     vl vdD+p+ + ll+++l++ +y +v++++++  al++l+e +  +Dl++ D+ mp+mdG++ll+     e++lp+i+++a+g+  ++ + +  G
  XP_010089952.1  20 VLAVDDDPTCLLLLETLLRRCQY-HVTTTSQAITALNMLREDKnrFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSANGDTRLVMKGITHG 112
                     799********************.***************887778*******************87754.558********************** PP

                     ESEEEESS--HHHHHH CS
    Response_reg  94 akdflsKpfdpeelvk 109
                     a d+l Kp+ +eel +
  XP_010089952.1 113 ACDYLLKPIRIEELKN 128
                     *************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363929.5E-1681670IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23001.5E-4117151No hitNo description
SuperFamilySSF521721.22E-3517142IPR011006CheY-like superfamily
SMARTSM004484.6E-3118130IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.72719134IPR001789Signal transduction response regulator, receiver domain
PfamPF000725.1E-2320128IPR001789Signal transduction response regulator, receiver domain
CDDcd001565.72E-2321134No hitNo description
SuperFamilySSF466897.7E-20203263IPR009057Homeodomain-like
PROSITE profilePS5129412.269203262IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-30204264IPR009057Homeodomain-like
TIGRFAMsTIGR015574.8E-25206259IPR006447Myb domain, plants
PfamPF002491.2E-6208258IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 674 aa     Download sequence    Send to blast
MTVEQRNDDP RDQFPIGMRV LAVDDDPTCL LLLETLLRRC QYHVTTTSQA ITALNMLRED  60
KNRFDLVISD VHMPDMDGFK LLELVGLEMD LPVIMLSANG DTRLVMKGIT HGACDYLLKP  120
IRIEELKNIW QHVIRRKKFD STNQKTSGNQ DRSNDGGGEG ELVSAGTGNS DHSGKVNKKR  180
KDQNEDDDED PDENGHDNDD PSTQKKPRVV WSVELHRKFV AAVNQLGIDK AVPKKILDLM  240
NVEKLTRENV ASHLQKYRLY LKRISCVANQ QANMVVALSS SDSSYLHMNS MNGLGNFNPL  300
TGSMQFQNPA FRSFPPGGMI GRLNTPSGLG LRGLPSSGMI QLGHAQTSGN SNNQVKFQPV  360
TLQGNNNGSI LPGIPMPYEL DQQRNKGLHI GDLSTTIDDT AVFPLSNSLP DVKIATGNGS  420
NNVISVTNNM LMLGHCQDAQ AGREFGNHSS VSVAPLKPEF CSPLQDPGRC NENWANSVQP  480
SGFQSNSFPL NDRQKHAALH RSSSRDNMSV MASQIGVNQF DASSIASASF RPDNSLSDSQ  540
SSMIQGWGNL HKQDSSCRPN LMSSSMNSLV PVNGGLGPLE QGLDLKNPMY HRNMDFDSMG  600
QPNYVDPLMV KYEEVEKSTM ETLKLKQAYL MDQQRPQGSY MSNNFDPLGD VVSAMMKQEQ  660
DKAEGEFDAY PLRV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-26202265164ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010089952.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010089952.10.0two-component response regulator ARR12 isoform X1
TrEMBLW9QUF00.0W9QUF0_9ROSA; Two-component response regulator
STRINGXP_010089952.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-126response regulator 12