PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010089502.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family NAC
Protein Properties Length: 391aa    MW: 42991 Da    PI: 7.7114
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010089502.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.81e-53271541128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeelvv+yLkkk+++ +l++  +i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+vl++
  XP_010089502.1  27 LPPGFRFHPTDEELVVHYLKKKATSAPLPV-AIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLTS 120
                     79****************************.88***************988899***************************************99 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++++vg+kk Lvfy g+ pkg kt+W+mheyrl
  XP_010089502.1 121 gGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRL 154
                     77788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-6517188IPR003441NAC domain
PROSITE profilePS5100562.01527188IPR003441NAC domain
PfamPF023653.8E-2828154IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009753Biological Processresponse to jasmonic acid
GO:0045995Biological Processregulation of embryonic development
GO:0048317Biological Processseed morphogenesis
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MESTDSSAGS QHHHQQQQQQ QQQQPNLPPG FRFHPTDEEL VVHYLKKKAT SAPLPVAIIA  60
EVDLYKFDPW ELPAKATFGE QEWYFFSPRD RKYPNGARPN RAATSGYWKA TGTDKPVLTS  120
GGTQKVGVKK ALVFYGGKPP KGIKTNWIMH EYRLAENKAN NKPPGCDLGN KKNSLRLDDW  180
VLCRIYKKNN TNRLLDHQER DHDSIDDMLG PINQSHLSNL VGPQNIGKLQ QQLPKSATLL  240
SYGSALSEND HNLFDGMLSC SNDNGININA AAAAAATTTT ALASSSCSKQ QPDHHQLPMK  300
RAVLPGMYWN DVVDNDDDGS GPGSSSTKRL QLDHDCLGTG TEGNSHANSL ATLLSQIPAQ  360
TTSLHQQSVL GGLGDGLFQR PFQLPGMNWF S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-75151903170Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family (Probable). Together with NAC018/NARS2, regulates embryogenesis by regulating the development and degeneration of ovule integuments, a process required for intertissue communication between the embryo and the maternal integument (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00361DAPTransfer from AT3G15510Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010089502.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By Jasmonic acid (JA). {ECO:0000269|PubMed:16805732}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010089502.10.0NAC transcription factor 56
SwissprotQ9LD441e-120NAC56_ARATH; NAC transcription factor 56
TrEMBLW9QIE50.0W9QIE5_9ROSA; NAC domain-containing protein 18
STRINGXP_010089502.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-117NAC domain containing protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]