PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010089257.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family SBP
Protein Properties Length: 433aa    MW: 47556.7 Da    PI: 7.511
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010089257.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP125.52.1e-39183260178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +CqvegC++ l +ak+yhrrhkvC +hskap+v+v gleqrfCqqCsrfh lsef+e+krsC+rrLa+hnerrrk+++
  XP_010089257.1 183 RCQVEGCHVALVNAKDYHRRHKVCAMHSKAPKVVVLGLEQRFCQQCSRFHVLSEFEESKRSCKRRLAGHNERRRKSSH 260
                     6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.6E-33178245IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.847181258IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.63E-38182263IPR004333Transcription factor, SBP-box
PfamPF031107.3E-31184257IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MEINGSNSNS NSTISTSLAW DVWELNNNNN TTSSRMDWTS TSTSTTSTAD ATGNGSFYAG  60
TGDGERQEAG GMGHAPLLNT ALHAQALHHH YYRHHHHHDQ NQEQHQQLTM YGGDGGSHLH  120
PDPHLVCLKL GKRHYFEDVT AAAVPVEERC VAGFAMGKKG KGFCGGGGGG GTTAATATAM  180
VPRCQVEGCH VALVNAKDYH RRHKVCAMHS KAPKVVVLGL EQRFCQQCSR FHVLSEFEES  240
KRSCKRRLAG HNERRRKSSH DSIARNSYHH ETKVLMGGGF PYLTSPTGRA LSLLSSKTDS  300
WVPPSDLSSR SSAALRELIA ENRAAILARQ LFLERDTWHL HHRNHHQQGE DLTSEAQQGG  360
FGSNIEPHHH QMFPEPPAHG GWERINESAA HVTLDLMQAP SPAFGFVPAR GKAKAEEEEC  420
SDLWNSFQGP NLV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-281842571184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1240247KRSCKRRL
2244255KRRLAGHNERRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010089257.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024032956.10.0squamosa promoter-binding-like protein 7
TrEMBLW9R3S10.0W9R3S1_9ROSA; Squamosa promoter-binding-like protein 7
STRINGXP_010089257.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96132738
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.18e-35squamosa promoter binding protein-like 9