PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010088702.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family NAC
Protein Properties Length: 420aa    MW: 47537 Da    PI: 8.8546
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010088702.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.21.6e-49381632128
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                     +pGfrFhPt+eelv +yL++kvegk++++ e i+ +d+y+++Pw+Lp+ ++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + s++
  XP_010088702.1  38 MPGFRFHPTEEELVEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPALAAIGEKEWFFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMIRSEN 131
                     79***************************.89***************8778899***************************************** PP

             NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                      + +glkktLvfy+g+apkg +t+W+m+eyrl
  XP_010088702.1 132 FRSIGLKKTLVFYSGKAPKGIRTSWIMNEYRL 163
                     ******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-5537183IPR003441NAC domain
PROSITE profilePS5100555.4837184IPR003441NAC domain
PfamPF023651.1E-2439163IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MAIAASSNST ITTTTMSQEN ESNNNNKTTD DHEHDMVMPG FRFHPTEEEL VEFYLRRKVE  60
GKRFNVELIT FLDLYRYDPW ELPALAAIGE KEWFFYVPRD RKYRNGDRPN RVTTSGYWKA  120
TGADRMIRSE NFRSIGLKKT LVFYSGKAPK GIRTSWIMNE YRLPQHETER YQKAEISLCR  180
VYKRAGVEDH PSLPRSLPSR ASSSRAAADN KKQYPNNAME KLQTFGVHQV LPPPPPPPHQ  240
FEVENTNETD GSSSSDVAAA GTKGLSKRKA YRGSIASPIA QPAAANTSME EEVAMLSAQQ  300
PKQFCPTLFS SGSSSTPPNS IDDLHRLIHN YQQAPSSSTT SSSNANIIVS HHHHSQQHYF  360
NQFHPMPLPL PVPVPPQQQQ VALNPLSNFL PTAFSDRLWE WNPFPDQANR DGQYSNNPFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-543918419165NO APICAL MERISTEM PROTEIN
1ut4_B3e-543918419165NO APICAL MERISTEM PROTEIN
1ut7_A3e-543918419165NO APICAL MERISTEM PROTEIN
1ut7_B3e-543918419165NO APICAL MERISTEM PROTEIN
4dul_A3e-543918419165NAC domain-containing protein 19
4dul_B3e-543918419165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010088702.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010088702.10.0NAC domain-containing protein 35
TrEMBLW9R2890.0W9R289_9ROSA; Putative NAC domain-containing protein 94
STRINGXP_010088702.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72033146
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.11e-108NAC domain containing protein 35