PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010088541.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family LBD
Protein Properties Length: 283aa    MW: 31686.7 Da    PI: 6.0867
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010088541.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260120.59.6e-38101091100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++r+kC+kdC+lap fpa+qp+kf ++h+l+G++n++++lka+  e ++dam+s+v+e+ +rar Pv+G++g+i++lq ql+ + +el+
  XP_010088541.1  10 ACAACKYQRKKCSKDCPLAPFFPADQPEKFHYAHRLYGVRNIMSILKAVCAESKQDAMTSIVFESAMRARFPVHGCLGIINQLQTQLQYALEELH 104
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     +++++
  XP_010088541.1 105 HVHTK 109
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.0369110IPR004883Lateral organ boundaries, LOB
PfamPF031952.1E-3510107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MTIKGGTSQA CAACKYQRKK CSKDCPLAPF FPADQPEKFH YAHRLYGVRN IMSILKAVCA  60
ESKQDAMTSI VFESAMRARF PVHGCLGIIN QLQTQLQYAL EELHHVHTKL AICKQQETPS  120
SSSHDPSPLQ LTITPNTNFI DPNQPSSSKM SMPMILNYDL INNRISGMYL NANYEGNNLK  180
PLMIQNPSFN SDEPLVQSSM FGSQEYPIQQ ELDVSQYDDI PFDPMIDDRS QEPYDSSGEQ  240
SLKNKIVESE YNISKTDLRD STTSVSKTEL ANAAASFSLT RGH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-2361107111LOB family transfactor Ramosa2.1
5ly0_B2e-2361107111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010088541.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010088541.10.0LOB domain-containing protein 12
TrEMBLW9QQR30.0W9QQR3_9ROSA; Uncharacterized protein
STRINGXP_010088541.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.11e-42LOB domain-containing protein 27