PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010088484.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family NAC
Protein Properties Length: 398aa    MW: 44745.7 Da    PI: 6.6524
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010088484.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM182.21.2e-56261531129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdee++++yL++kv ++++++ ++i e+d++k+ePwdLpkk+k +ekewyfF++rd+ky+tg r+nrat+sgyWkatgkdke+++ 
  XP_010088484.1  26 LPPGFRFHPTDEEIITCYLTEKVINSNFSA-SAIGEADLNKCEPWDLPKKAKMGEKEWYFFCQRDRKYPTGMRTNRATESGYWKATGKDKEIYKG 119
                     79**************************99.88***************99999*****************************************9 PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                     kg lvg+kktLvfy+grapkgek++Wvmheyrle
  XP_010088484.1 120 KGCLVGMKKTLVFYRGRAPKGEKSNWVMHEYRLE 153
                     ********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-6418178IPR003441NAC domain
PROSITE profilePS5100559.65726177IPR003441NAC domain
PfamPF023653.4E-2927152IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MEEGCVVENK GSSEDHHHHH RELIDLPPGF RFHPTDEEII TCYLTEKVIN SNFSASAIGE  60
ADLNKCEPWD LPKKAKMGEK EWYFFCQRDR KYPTGMRTNR ATESGYWKAT GKDKEIYKGK  120
GCLVGMKKTL VFYRGRAPKG EKSNWVMHEY RLEGKFSYYN LPKSAKDEWV VCRVFHKNMG  180
INNNKKLAPI PGLLRINSLG VDDMLDCSTT LPPLTDDPPY NSTANYGEND AADFKGSTTA  240
NFNNSASSQG ASHIINYYSL IAPNNNKSVL HHQHQINPIH QNPILYSQII PSSSYDNSSF  300
QRNSNPGYFQ IGSSSTITGQ CKVEQFSVSN QSMVSLSQDT GLSTDNMNNN TTEISSVVSK  360
HDMGSSHNRS SYHDHQDFEG PSSVGPISDI EAFIWDDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-532417815166NO APICAL MERISTEM PROTEIN
1ut4_B5e-532417815166NO APICAL MERISTEM PROTEIN
1ut7_A5e-532417815166NO APICAL MERISTEM PROTEIN
1ut7_B5e-532417815166NO APICAL MERISTEM PROTEIN
4dul_A5e-532417815166NAC domain-containing protein 19
4dul_B5e-532417815166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00518DAPTransfer from AT5G18270Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010088484.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010088484.10.0NAC domain-containing protein 87
SwissprotQ9FK441e-118NAC87_ARATH; NAC domain-containing protein 87
TrEMBLW9QN110.0W9QN11_9ROSA; NAC domain-containing protein 100
STRINGXP_010088484.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.11e-115Arabidopsis NAC domain containing protein 87
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]