PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010088481.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family NAC
Protein Properties Length: 358aa    MW: 40420.6 Da    PI: 8.0331
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010088481.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.74.6e-5381391128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+ +yL+k+v + +l++ ++i+evdiyk++PwdLp+k++ +ekewyfFs+rd+ky++g r+nra++sgyWkatg+dk++++ 
  XP_010088481.1   8 LPPGFRFHPTDEELILHYLRKRVISIPLPV-SIIAEVDIYKFDPWDLPAKATFGEKEWYFFSPRDRKYPNGARPNRAAASGYWKATGTDKTIMTL 101
                     79****************************.89***************988899***************************************98 PP

             NAM  96 .....kgelvglkktLvfykgrapkgektdWvmheyrl 128
                          +++++g+kk Lvfykgr pkg+kt+W+mheyrl
  XP_010088481.1 102 vtpggGQQNIGVKKALVFYKGRPPKGVKTNWIMHEYRL 139
                     999988889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-645175IPR003441NAC domain
PROSITE profilePS5100561.8178175IPR003441NAC domain
PfamPF023653.1E-279139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MKNPQTSLPP GFRFHPTDEE LILHYLRKRV ISIPLPVSII AEVDIYKFDP WDLPAKATFG  60
EKEWYFFSPR DRKYPNGARP NRAAASGYWK ATGTDKTIMT LVTPGGGQQN IGVKKALVFY  120
KGRPPKGVKT NWIMHEYRLA ETPTYTYSNV NKSNNKFKDS SMRLDDWVLC RIYKKTNVVH  180
PIASFPSDQE EEEQFIQDAP LPSLIGDQQD SFKPQKSSSF SDLLDAMDYS ILSNLLADCP  240
SNSTSGFDQS ISSIPGFDIG SPDQPFYNGC VGNSSGNYML QKLPQLQFSA PTTAENRLKR  300
QLPTGTGDDH QAPPKKYMNS FSLISSNIQS EIPQNNLMNQ LFLNQQLFLS PELQFQGY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-71517514165NO APICAL MERISTEM PROTEIN
1ut4_B7e-71517514165NO APICAL MERISTEM PROTEIN
1ut7_A7e-71517514165NO APICAL MERISTEM PROTEIN
1ut7_B7e-71517514165NO APICAL MERISTEM PROTEIN
3swm_A7e-71517517168NAC domain-containing protein 19
3swm_B7e-71517517168NAC domain-containing protein 19
3swm_C7e-71517517168NAC domain-containing protein 19
3swm_D7e-71517517168NAC domain-containing protein 19
3swp_A7e-71517517168NAC domain-containing protein 19
3swp_B7e-71517517168NAC domain-containing protein 19
3swp_C7e-71517517168NAC domain-containing protein 19
3swp_D7e-71517517168NAC domain-containing protein 19
4dul_A7e-71517514165NAC domain-containing protein 19
4dul_B7e-71517514165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the promoter of ACO5, an ACC oxidase involved in ethylene biosynthesis. Mediates waterlogging-induced hyponastic leaf movement, and cell expansion in abaxial cells of the basal petiole region, by directly regulating the expression of ACO5 (PubMed:24363315). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:24363315}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00333DAPTransfer from AT3G04070Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010088481.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By root flooding (PubMed:24363315). Induced by senescence (PubMed:24659488). {ECO:0000269|PubMed:24363315, ECO:0000269|PubMed:24659488}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010088481.10.0NAC transcription factor 47
SwissprotQ84TD61e-111NAC47_ARATH; NAC transcription factor 47
TrEMBLW9QFW10.0W9QFW1_9ROSA; NAC domain-containing protein 29
STRINGXP_010088481.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66212750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.11e-107NAC domain containing protein 47
Publications ? help Back to Top
  1. Hofmann NR
    A NAC transcription factor for flooding: SHYG helps plants keep their leaves in the air.
    Plant Cell, 2013. 25(12): p. 4771
    [PMID:24363314]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]