PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010087532.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family LBD
Protein Properties Length: 179aa    MW: 19931.7 Da    PI: 6.7793
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010087532.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.11.8e-4461051100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +Ca+Ck+lrr+CakdC++apyfp+e+p+kfa+vhk+FGasnv+k+l+++p ++r da+sslvyeA+ar+rdP+yG+vg i+ lq+q+++l+ +la
  XP_010087532.1   6 PCASCKLLRRRCAKDCIFAPYFPSEDPHKFAIVHKVFGASNVSKMLQEIPVHQRADAVSSLVYEANARMRDPIYGCVGAISYLQNQVSELQMQLA 100
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_010087532.1 101 VAHAE 105
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.545106IPR004883Lateral organ boundaries, LOB
PfamPF031959.3E-446103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MGGNPPCASC KLLRRRCAKD CIFAPYFPSE DPHKFAIVHK VFGASNVSKM LQEIPVHQRA  60
DAVSSLVYEA NARMRDPIYG CVGAISYLQN QVSELQMQLA VAHAEILCIQ MQQEPMVATS  120
PPQIFDPAND HDDQKSYFVG HNNNLVPADQ FHKFASASNI VVHDSFKRES IFGHDMVSL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010087532.11e-132hypothetical protein L484_006937
SwissprotQ8LBW34e-73LBD12_ARATH; LOB domain-containing protein 12
TrEMBLW9QYS91e-132W9QYS9_9R
STRINGVIT_13s0067g01880.t014e-87(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-74LBD family protein