PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010087331.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family bZIP
Protein Properties Length: 217aa    MW: 24382.5 Da    PI: 9.7598
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010087331.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.47.3e-14103161563
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                     +r +r+++NRe+ArrsR R+k++ieeL+  v +L++ N++L ++l +l +  ++  +e+
  XP_010087331.1 103 RRLKRMISNRESARRSRMRRKMQIEELQYLVGQLQTTNRQLSEKLIQLLDCNQQILQEN 161
                     789*********************************************99999999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.1E-1199163IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.5E-11101156No hitNo description
PROSITE profilePS5021710.277101164IPR004827Basic-leucine zipper domain
PfamPF001706.9E-13103161IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.06E-10103157No hitNo description
CDDcd147021.74E-13104151No hitNo description
PROSITE patternPS000360106121IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MEKNNELKAS LTQKQPQYYP GTINKHALEL VNLGHYSLSQ QNPNSQSSNI SDPILPFAIS  60
TAARLFPNNL SMSPGNDDST TDDSREIGRG REVGVGVVVN NERRLKRMIS NRESARRSRM  120
RRKMQIEELQ YLVGQLQTTN RQLSEKLIQL LDCNQQILQE NSQLKEKVSS LQIILSDLLV  180
PLRNNAGEDH NSSADRMLKA QGSSTPSVTI SSMQLLH
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010087331.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010087331.21e-100basic leucine zipper 43
TrEMBLW9QY741e-155W9QY74_9ROSA; G-box-binding factor 1
STRINGXP_010087331.11e-156(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130442430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60830.15e-20basic leucine-zipper 70