PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013901746.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
Family ARR-B
Protein Properties Length: 616aa    MW: 64226.4 Da    PI: 6.9637
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013901746.1genomeBUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.13.9e-28176229155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kpr++W+ e+H++Fv av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  XP_013901746.1 176 KPRVVWSVEMHQQFVAAVNQL-GIDKAVPKKILELMSVEGLTRENVASHLQKYRL 229
                     79*******************.********************************8 PP

2Response_reg38.65.8e-142683157
                    EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSE CS
    Response_reg  1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmd 57
                    v++vdD+pl +++++q+l++  y +v +++++ +al+ll+ek+  +Dl+l D+ mp m+
  XP_013901746.1 26 VMVVDDDPLCLRVVEQMLKRCTY-DVHTCTNAASALQLLREKRhgFDLVLSDVYMPVMS 83
                    89*********************.***************999999***********985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23001.1E-172182No hitNo description
SuperFamilySSF521722.13E-2623126IPR011006CheY-like superfamily
SMARTSM004481.7E-1824116IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011016.61525120IPR001789Signal transduction response regulator, receiver domain
PfamPF000728.4E-102682IPR001789Signal transduction response regulator, receiver domain
CDDcd001563.84E-1827120No hitNo description
Gene3DG3DSA:3.40.50.23001.5E-983131No hitNo description
PROSITE profilePS5129410.42173232IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.1E-30173234IPR009057Homeodomain-like
SuperFamilySSF466891.72E-19174233IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-24176229IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 616 aa     Download sequence    Send to blast
MDVKQDNGEH GAQWQRAWSG PAGLRVMVVD DDPLCLRVVE QMLKRCTYDV HTCTNAASAL  60
QLLREKRHGF DLVLSDVYMP VMSSNGEHGT VLRGVTHGAC DFLIKPVRIE ELRNIWQHVI  120
RRHRAWVPDG DKEEAGGDAA MEGETPSKKR KDKEAAGRDG SCSGGEREEE GSSSKKPRVV  180
WSVEMHQQFV AAVNQLGIDK AVPKKILELM SVEGLTRENV ASHLQKYRLY LRRVQAVAAE  240
GGVAPTMQLG PSGVGGAGSR PSVLKQSAVA AVAAAAAAGA AAQSSGGEAP TPVSPPSQQQ  300
QVAGAGVPHP QQPQPPQTNH HHPQQQQQPA IKDERGPTQQ QQLQRSVSVG ASAAAAPLPG  360
TGPQDPAAAA AAAAAAAAAA ASMMGAPAPG LGGPAVVQGA MGLNPMAMMG LGPMGMQAQM  420
GMAGMSQLMA GGVGSMGMPA ALGGAGMGGG PMGLAGLPGG LTSMGSDPSQ MLSLMAGMAM  480
YQHAQHAALQ QAQQQQLAAQ QQAQQQQQQP PLAHLQQAHH LQQLNGRHMA AQGQQQQQQQ  540
QQQQQQQQQQ QQQQPAFGGD AAVSMEANDF ASVFDDHFGL PRSGVAGVTG VTGVTGLGPG  600
RGEGDVGEFL DYFLKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-22172234163ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013901746.10.0Two-component response regulator ARR18
TrEMBLA0A0D2MQM30.0A0A0D2MQM3_9CHLO; Two-component response regulator ARR18
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP12201516
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.18e-69response regulator 1
Publications ? help Back to Top
  1. Bogen C, et al.
    Reconstruction of the lipid metabolism for the microalga Monoraphidium neglectum from its genome sequence reveals characteristics suitable for biofuel production.
    BMC Genomics, 2013. 14: p. 926
    [PMID:24373495]