PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013896461.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
Family B3
Protein Properties Length: 700aa    MW: 72722.9 Da    PI: 10.3853
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013896461.1genomeBUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B334.15e-116536985398
                     EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3  53 rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                     ++++++  lt+GW++Fv+a+++ +gD+vvF++ g+++ +l+ ++ r
  XP_013896461.1 653 CNTQRHLRLTSGWRDFVRAHNVLVGDTVVFERRGDDRSTLYTSIKR 698
                     78888999***********************999888888887766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.106.5E-9600689IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-9602692IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.389635700IPR003340B3 DNA binding domain
PfamPF023621.8E-8651699IPR003340B3 DNA binding domain
CDDcd100175.66E-8652698No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 700 aa     Download sequence    Send to blast
MDYQHYRDGG VAPHLAPRGQ GAASTTGTKR AAEAFPQKSA GGLQQAESLQ GPSKRLCAPQ  60
QCDSAVSSIT TWGPHAGNGG GAGGDLPLWR TLSSSTSAPA AAAATASAAM TPQDMALRDA  120
PAGGSFSAGA PPPSMMRVGS SMGGGAALQQ LRWPQQPSTS QPAASLLLEP GTGMDATVAA  180
VAAAAAAMQR HASGGGGGAA DGGRLLPPAA AASCGSSNKM VSPFTSGVLA CTAALWPQEL  240
RYLSAVGTAR QHSAALPLRT ASAPILSNGL SAGAGAAVAA NAALAAAANA APAAPAGLRG  300
GMEGPAQQYQ LPMPRPLVSR LASEAPAPAG PGGGDFRHLQ RGYSAPITQL LLQQQALQQQ  360
LIASAGAGAR GGAPSGGAAA PQLEQAPRLD LVGAGSLQRQ SSLMQQQASL QHQAPLQQQT  420
SLQHPQLLAQ QQQQQQQQQQ QQQQQQQAAL QQQQQQQQQQ QQQQHQQQQQ QQQQQQQQQA  480
AIQQLTTQQS LVKQESSQQQ QQQQQQQQQQ QQQQQQQQQA PLPLVRQPSR REQQQQKQQA  540
KQQPAAPAAE AVPAAGAAPG ADGPRGTAGE AQGAGARGAP SSTDDKTVKM SRAISCKAYL  600
KRLNITQPMA EALLPEMQLA TAPRGGSCAS GQGASKHYEL LFKRELVYEG AVCNTQRHLR  660
LTSGWRDFVR AHNVLVGDTV VFERRGDDRS TLYTSIKRAA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013896461.10.0hypothetical protein MNEG_10522
TrEMBLA0A0D2M8N60.0A0A0D2M8N6_9CHLO; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP815022
Publications ? help Back to Top
  1. Bogen C, et al.
    Reconstruction of the lipid metabolism for the microalga Monoraphidium neglectum from its genome sequence reveals characteristics suitable for biofuel production.
    BMC Genomics, 2013. 14: p. 926
    [PMID:24373495]