PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.M01177.1.p
Common NameLOC105968368, MIMGU_mgv1a027127mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family Dof
Protein Properties Length: 294aa    MW: 32314.5 Da    PI: 6.0259
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.M01177.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof107.95.2e-3451106459
            zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                         lkcprC stntkfCyynny+ sqPr+fCk+C+r+WtkGG+lr vP+Gggr++++
  Migut.M01177.1.p  51 PPLKCPRCASTNTKFCYYNNYNKSQPRHFCKSCKRHWTKGGTLRTVPLGGGRKNKR 106
                       6789**********************************************977665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-2247106IPR003851Zinc finger, Dof-type
PfamPF027013.0E-3052105IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.72953107IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105591IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MGLSSEHVSA DHRDDIIQGF DWGGQRSSSG APPPELSKPP PIRRPQQSSE PPLKCPRCAS  60
TNTKFCYYNN YNKSQPRHFC KSCKRHWTKG GTLRTVPLGG GRKNKRPKIS NPSTTTAAVH  120
QEDDKPNNFP STILYQSLIN NATSSPPLLH QTRDSCTNII IGINGGADST TISTGLNINN  180
NPNAEFHEFT SFDMMSNASV GPTSYNDSLN VFDHNYPAGN LEYSMEESTI TTVNYIPTSS  240
GSGPSLWPGP NTTSSLEMPS YWNWNEIDDV LTSSDHLDIS WPDDDYDKAE IKP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012848450.10.0PREDICTED: dof zinc finger protein DOF1.6-like
TrEMBLA0A022QJ280.0A0A022QJ28_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61712033
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.11e-28TARGET OF MONOPTEROS 6