PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.M01136.1.p
Common NameLOC105968811, MIMGU_mgv1a013945mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family bHLH
Protein Properties Length: 206aa    MW: 22836.7 Da    PI: 7.0441
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.M01136.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH34.53.8e-111563555
                      HHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
               HLH  5 hnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55
                       + +E++RR+++++ +++L +l+P +  +p + +s  + Le A +YI++Lq
  Migut.M01136.1.p 15 RKTIEKNRRNQMKDLYNKLTSLVPRP--NPRELVSLPDQLEGAANYIQKLQ 63
                      5789*********************7..37777*****************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000831.15E-6867No hitNo description
SuperFamilySSF474593.79E-12880IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088810.7471062IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.104.5E-111275IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003532.9E-41668IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.5E-71663IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0050832Biological Processdefense response to fungus
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MEPQNPSSSS FKADRKTIEK NRRNQMKDLY NKLTSLVPRP NPRELVSLPD QLEGAANYIQ  60
KLQHDLEKMK QKKNCLLMGT VSANSTTTTA TTTTTTNKSS ISNTDNNNNN NGGINLPDID  120
VRVTGSALEV VVITGQNSHF MFSEIIRMLH EEEGAEVVNA SFSMLQDSVF HTLHCKIGEC  180
LVQDYDGAAA ARISEKLRKF VYEVN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.M01136.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012848938.11e-153PREDICTED: transcription factor bHLH125
TrEMBLA0A022QK961e-151A0A022QK96_ERYGU; Uncharacterized protein
STRINGMigut.M01136.1.p1e-152(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51052131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G20970.12e-42bHLH family protein