PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.L01765.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family GRF
Protein Properties Length: 305aa    MW: 33333.4 Da    PI: 9.5445
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.L01765.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC82.83e-2674117144
               WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                       d+epgrCrRtDGKkWRCsr+v++g+k+CErH+hrgr+rsrk++e
  Migut.L01765.2.p  74 DPEPGRCRRTDGKKWRCSRDVVAGHKYCERHMHRGRNRSRKPVE 117
                       79***************************************987 PP

2QLQ44.93.4e-16439136
               QLQ  1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                      s+F+ +Q+q+L+ Q+l++++++a++ vPpeLl  ++
  Migut.L01765.2.p  4 SHFSLTQWQELELQALIFRHMIAGATVPPELLHLVK 39
                      79*****************************98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.0E-9440IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.1E-11538IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.247540IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.76274118IPR014977WRC domain
PfamPF088793.5E-2275117IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MGSSHFSLTQ WQELELQALI FRHMIAGATV PPELLHLVKK SIIVNYPPSS YHHYYPHYQP  60
ALLQSGYWGK SAMDPEPGRC RRTDGKKWRC SRDVVAGHKY CERHMHRGRN RSRKPVEIPT  120
PKSNQGAVSA TSTGTGGGFP RFTLSAPSDL LHLNQSDICR PTNSIIETKV HLQQSQTNNK  180
TLRHFFDDWP PKPLGHEDDN SMMTSSSSTK LSISMPENPS SDFSLKLGTG GDGGEAAGGN  240
RVIVDENSSS SSRLNWGMMT WQNNPAAPMG GPLAEALRSS VSNSSPTSVL HRLPPGGASQ  300
SSYV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012836103.10.0PREDICTED: growth-regulating factor 3 isoform X1
SwissprotQ8L8A77e-67GRF4_ARATH; Growth-regulating factor 4
TrEMBLA0A022RI871e-175A0A022RI87_ERYGU; Uncharacterized protein
STRINGVIT_08s0007g03760.t011e-101(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52910.16e-51growth-regulating factor 4