PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.L01347.1.p
Common NameLOC105967594, MIMGU_mgv1a011043mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family HD-ZIP
Protein Properties Length: 295aa    MW: 33614.1 Da    PI: 4.3806
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.L01347.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.52.2e-1886138456
                       -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       ++++ +eq+  Le+ F  ++++  +++++LAk+lgL+ rqV +WFqNrRa+ k
  Migut.L01347.1.p  86 KRRLMPEQVLFLEKSFDVENKLEPDRKTQLAKQLGLQPRQVAIWFQNRRARSK 138
                       457889*********************************************99 PP

2HD-ZIP_I/II120.86.9e-3985175292
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                       kkrrl  eqv +LE+sF+ e+kLep+rK++la++Lglqprqva+WFqnrRAR ktk lE++y +Lk++yd+lke+ ++L k++e++++e++
  Migut.L01347.1.p  85 KKRRLMPEQVLFLEKSFDVENKLEPDRKTQLAKQLGLQPRQVAIWFQNRRARSKTKVLEREYGSLKASYDKLKEDYDTLFKQNEAMKAEVD 175
                       9*************************************************************************************99886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.36E-1872140IPR009057Homeodomain-like
PROSITE profilePS5007116.64980140IPR001356Homeobox domain
SMARTSM003891.8E-1684144IPR001356Homeobox domain
CDDcd000861.70E-1585140No hitNo description
PfamPF000461.4E-1586138IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.5E-1887146IPR009057Homeodomain-like
PRINTSPR000313.8E-6111120IPR000047Helix-turn-helix motif
PROSITE patternPS000270115138IPR017970Homeobox, conserved site
PRINTSPR000313.8E-6120136IPR000047Helix-turn-helix motif
PfamPF021835.1E-14140181IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MEVDGVYEDS HVPTVFAKNE ILDSLWAPNS SPSFHGSSSM VNFEDDKNTE RERPFFDICK  60
SERFNDDDEV SYEDEYSGFH KPAGKKRRLM PEQVLFLEKS FDVENKLEPD RKTQLAKQLG  120
LQPRQVAIWF QNRRARSKTK VLEREYGSLK ASYDKLKEDY DTLFKQNEAM KAEVDLLTEK  180
LVMREKVLSE PVVAPLDLLP KNVDAASNSA KSDVFDSESS HYNTLMEGGA DYSSRVFEVE  240
GSGEFSQEEE EDGVSGLVPK IEGEEWCGDD HDLQPNSGNL GFPVQHQGTW LWQY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012847654.10.0PREDICTED: homeobox-leucine zipper protein ATHB-54-like
SwissprotQ022832e-41HAT5_ARATH; Homeobox-leucine zipper protein HAT5
TrEMBLA0A022QM620.0A0A022QM62_ERYGU; Uncharacterized protein
STRINGPGSC0003DMT4000454711e-77(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8252495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.16e-41homeobox 1