PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.L01138.1.p
Common NameLOC105967485, MIMGU_mgv1a014639mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family bZIP
Protein Properties Length: 184aa    MW: 21340.7 Da    PI: 5.1095
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.L01138.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.71.2e-1378127554
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                       +++rr+++NRe+ArrsR RK+  ++eL   v  L +eN+ L ++l++ ++
  Migut.L01138.1.p  78 RKQRRMISNRESARRSRMRKQRHLDELWGQVLRLRNENQNLVEKLSHVSE 127
                       79******************************************998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.2E-1674138IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.90976139IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.77E-1278127No hitNo description
Gene3DG3DSA:1.20.5.1703.5E-1278151No hitNo description
PfamPF001702.8E-1178127IPR004827Basic-leucine zipper domain
CDDcd147021.06E-1779129No hitNo description
PROSITE patternPS0003608196IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MMQSEIQEMH YFAPQNPSPY QPNFNLIQNT SPSMQYNRFV PANLPNYPPI SLLNELCPNS  60
NSTSDEAEDN QVGLVDERKQ RRMISNRESA RRSRMRKQRH LDELWGQVLR LRNENQNLVE  120
KLSHVSESHG RVVEENARLK EEASDLRQML MDAQISNSYA VLRDFEDLES SEQSVVTSKN  180
LFD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19097RRSRMRKQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.L01138.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012847538.11e-132PREDICTED: basic leucine zipper 43
TrEMBLA0A022QQZ81e-131A0A022QQZ8_ERYGU; Uncharacterized protein
STRINGMigut.L01138.1.p1e-131(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9472492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.14e-42basic leucine-zipper 42